KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1031Help
Entry
SP_1031           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAK75146
UniProt: A0A0H2UPS8
Position
973184..973285
Genome map
AA seq 33 aa AA seqDB search
MNDVAIILETKSEERDISKQIFIDELMKNIDII
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgtagcaataatccttgaaacaaaatcagaagaaagagatattagcaaacaa
atttttattgatgagttaatgaaaaatatagacataatttaa

DBGET integrated database retrieval system