KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1033Help
Entry
SP_1033           CDS       T00057                                 

Definition
(GenBank) iron-compound ABC transporter, permease protein
  KO
K02015  iron complex transport system permease protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Module
spn_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1033
Transporters [BR:spn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SP_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD SieB
Motif
Other DBs
NCBI-ProteinID: AAK75148
UniProt: A0A0H2UPZ7
Position
974409..975428
Genome map
AA seq 339 aa AA seqDB search
MHAKMRNKKQINLGIIFIICLGLLITIFLSLKLGTKEINIRDFLAAFGMGNTNDDFIKSI
IYKRIPRTIFAILAGSSLAISGVLMQSVTRNPIADPGILGINTGASLSVVIGLSFLGISS
SISHISFAIIGGLVSAIFVYAIAVSGKAGLTPIKLALSGTCVSMALSSFVSFLILPNNNV
LDKFRFWQIGSLGAATLSSISTLLPFIILGHLIAIFISSDLNALAMGDEMAVGLGVNVNR
IRSLAIIASVLLCSSITAIGGPIGFVGLIVPHFCGLFISKDIRTMTISSSFIGAELLLIC
DIIGRMLGKPGEIEVGIITAIIGGPVLIYVTMKNRGVNN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcaaaaatgcgaaataaaaaacaaataaacctaggcataatttttataatctgc
ctaggtcttcttattacaatatttttgtcattaaagcttggaacaaaagaaattaatatc
agagattttttagcagcttttggaatgggtaatacaaatgatgattttattaaatcaatt
atatataaaagaatacctagaactatttttgcaattttagcaggttctagtcttgccata
agcggtgtattgatgcaatcagttactagaaacccaatagctgatccaggtatactcggt
ataaacacaggagcaagtcttagtgtagtaattggtctttcttttttaggaatttcatca
agcataagccatataagttttgcaatcattggtggcttagtaagtgcaatttttgtatac
gcgattgctgtaagcggaaaagcaggccttacccctataaaacttgccttatcaggaact
tgtgttagtatggctttaagcagttttgtaagttttttaattttaccgaataataacgtc
ttagacaaatttagattttggcaaataggtagccttggagcagctacattatcttctata
tctacactactaccttttataattttaggtcacttgatagctatatttatttcatcagat
ttaaacgctttagctatgggtgatgaaatggctgttggtcttggagttaatgttaatagg
ataagatcacttgcaataattgcaagtgtgcttttatgttcaagtattactgcaattggt
ggacctattggcttcgtaggtcttatagttcctcacttttgtggcttatttataagcaaa
gatatacgcacaatgaccatttcttcatcttttataggtgcagagctcttgcttatatgt
gatataatcggccgtatgttaggtaaaccaggtgaaattgaagtagggataattactgca
ataatcgggggtccagtacttatttatgtaactatgaaaaatagaggggttaataactaa

DBGET integrated database retrieval system