KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1034Help
Entry
SP_1034           CDS       T00057                                 

Definition
(GenBank) iron-compound ABC transporter, permease protein
  KO
K02015  iron complex transport system permease protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Module
spn_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1034
Transporters [BR:spn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SP_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: AAK75149
UniProt: A0A0H2UQ01
Position
975428..976435
Genome map
AA seq 335 aa AA seqDB search
MQNLIIGIQKRKNRITLFSSLFLLIIISLSFFILLIGDESYSFSTLIKVLNSETVPGASF
SIMEIRLPKLLAGIIAGWSFGLAGFIFQTMLRNPLASPDIIGVTSSSSIAAVFCILVLKT
NSLTTGIISITCGLTSSLILFLLAKKDGFSAARLIILGIGFQAVTRAGTSFLLLKVARYE
LQEVMRWLSGSLSFTKLDDIPLVLIVSIIATILVLFFNKRLEIIELGEEIAIGLGANPEL
SRLVLIFCAVSLTAFSTSITGPIACISFLAGPIALNIGKKRSPILAGLVGILLVLLSDIF
SQNILPARYPVGVVTGLLGSPYLIYLLIKMNRRNI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttaattataggtattcaaaaaagaaaaaatagaataacactattttcctca
ctatttttattaataataatcagtctatcatttttcattttacttatcggagatgaaagt
tattctttttcaactttgattaaagtcttaaatagtgaaactgttcctggagctagtttt
tcgattatggaaattagattaccaaaattattagcaggaattatagctggctggtctttt
ggattggcaggatttatctttcaaactatgttaagaaatcctcttgcaagtcctgatata
atcggtgtcacaagttcttcatctattgcagcggtcttttgcatattggtattaaaaaca
aatagtttaactactggaattatttcaataacttgtggactaacatcatctttaatatta
tttttactagctaaaaaagatggtttttcagcagcaagactgataatattaggtattggt
tttcaagctgtcacaagagcaggcacctcatttttattgttgaaagtagcaagatatgaa
ttacaagaagttatgagatggctcagtggctctttatcttttacaaagttagatgacata
cctcttgttctaatagtaagtattattgctactatattagttttattttttaataaaaga
ctagaaattattgaacttggtgaagaaatagcaatcggacttggagcaaatcccgagctt
tcaaggcttgttttaattttttgcgctgtatctttaactgctttttctacttcaattaca
ggaccaatagcttgtatatcttttttagctggtcccatagccttaaatattggcaagaaa
agaagcccaatattagctggattggttggaattttactagttttgttatcagacatattc
tctcaaaatattttaccagctagatatccagtaggtgttgtaactggcttgttaggttca
ccatacttaatatacttactaataaaaatgaacaggaggaatatataa

DBGET integrated database retrieval system