KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1035Help
Entry
SP_1035           CDS       T00057                                 

Definition
(GenBank) iron-compound ABC transporter, ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Module
spn_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1035
Transporters [BR:spn02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SP_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 SMC_N Mg_chelatase RsgA_GTPase AAA_29 AAA_23 AAA_22 ABC_ATPase Rad17 AAA_16 AAA_14 ATPase_2 AAA_28 BCA_ABC_TP_C Viral_helicase1 NACHT AAA_10 RNA_helicase AAA_5 AAA_27 AAA_30 AAA_18 Adeno_IVa2 AAA_13 AAA_33 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AAK75150
UniProt: A0A0H2UPS9
Position
976435..977229
Genome map
AA seq 264 aa AA seqDB search
MKGLWSNNLTCGYDEKIILENINIKIPEEKISVIIGSNGCGKSTLIKTLSRLIKPLEGEV
LLDNKSINSYKEKDLAKHIAILPQSPIIPESITVADLVSRGRFPYRKPFKSLGKDDLEII
NRSMVKANVEDLANNLVEELSGGQRQRVWIALALAQDTSILLLDEPTTYLDISYQIELLD
LLTDLNQKYKTTICMILHDINLTARYADYLFAIKEGKLVAEGKPEDILNDKLVKDIFNLE
AKIIRDPISNSPLMIPIGKHHVNS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtctgtggtcaaataatcttacctgcggttatgatgaaaaaataatcttggaa
aatataaatataaaaatacctgaagaaaaaatatcagttattattgggtcaaatggttgt
gggaaatcaacactcattaaaaccttgtctcgacttataaagccattagagggagaagta
ttgcttgataataaatcaattaattcttataaagaaaaagatttagcaaaacacatagct
atattacctcaatctccaataatccctgaatcaataacagtagctgatcttgtaagccgt
ggtcgtttcccctacagaaagccttttaagagtcttggaaaagatgaccttgaaataata
aacagatcaatggttaaggccaatgttgaagatctagcaaataacctagttgaagaactt
tctgggggtcaaaggcaaagagtatggatagctctagccctagcccaagatacaagtatc
ctacttttagatgagccaactacttacttggatatctcatatcaaatagaactattagac
ctcttgactgatctaaaccaaaaatataagacaaccatttgcatgattttgcacgatata
aatctaacagcaagatacgctgattacctatttgcaattaaagaaggtaaacttgttgca
gagggaaagcctgaagatatactaaatgataaactagttaaagatatctttaatcttgaa
gcaaaaattatacgtgaccctatttccaattcgcctctaatgattcctattggcaagcac
catgttaactcttaa

DBGET integrated database retrieval system