KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1037Help
Entry
SP_1037           CDS       T00057                                 

Definition
(GenBank) putative type II restriction endonuclease
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S
Motif
Other DBs
NCBI-ProteinID: AAK75152
UniProt: A0A0H2UPU0
Position
977797..978006
Genome map
AA seq 69 aa AA seqDB search
MKIHCLKLKNKELNKEVAFYLTSIIRQALKNTEYKDQISSTVLPDIKIKLPIDSRGTPDW
NYMERYRDR
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcattgtttaaaattaaaaaataaagaattgaataaagaagtagcattctat
ttaacttcaattattaggcaagctttaaaaaatactgaatataaagatcaaatatctagc
acagtattgccagatatcaaaattaaattaccgatagacagtagaggtactccagattgg
aattacatggaaagatatagagatagataa

DBGET integrated database retrieval system