KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1038Help
Entry
SP_1038           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAK75153
UniProt: A0A0H2UQ04
Position
978131..978286
Genome map
AA seq 51 aa AA seqDB search
MINKLSRYMESSGKTYQNHYVTILKWYEEDKDKLRQKGLNKKMNYDVGESL
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaactatccagatacatggaaagcagtggtaagacctatcaaaaccactat
gtgacaatcttaaaatggtatgaagaagataaagacaaactaagacagaaaggtttaaat
aaaaaaatgaattatgatgtaggagaatctttatag

DBGET integrated database retrieval system