KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1040Help
Entry
SP_1040           CDS       T00057                                 

Definition
(GenBank) site-specific recombinase, resolvase family
  KO
K06400  site-specific DNA recombinase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    SP_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase Recombinase Zn_ribbon_recom DpnI CENP-F_leu_zip Catalase-rel DUF1664 Cnn_1N
Motif
Other DBs
NCBI-ProteinID: AAK75155
UniProt: A0A0H2UPT4
Structure
PDB: 

Position
979223..980902
Genome map
AA seq 559 aa AA seqDB search
MSKEKIKVYLYTRVSTSIQIEGYSLEAQKSRMKAFAIYNDYEIVGEYEDAGKSDKSIEGR
IQFNRMMEDIKSGKDGVSFVLVFKLSRFARNAADVLSTLHIMQDYGVNLICVEDGIDSSK
DAGKLMISVLSAVAEIERENISIQTMEGRIQKAGEGKWNGGFAPYGYKLEDGKLFINEEE
AVAIRTIFDQYVNTTIGANGISKYLENHGIRKIPRQNGKNPLFDAGLIRKILKNPVYNGK
IAFGRRTLEKVHGTRNEYKQVEQDEYLISEGIHEAIVSDEVWQAAQVKLKSQAKKYEHVN
KGKDTRTHLLSGIVKCPICGVGMFGNKCIKKKKDGTKYKDFYYYGCNHRQMIRGNKCTFS
KQIREELLDDAVAEVIVKIVSNPKFASMMQEKINMKVDTSEIEKEIDNYQKELRKSHSTK
FKLIEEIDNLDVEDKHYKRRKQDLDDRLYRMYDKLDELESSLIDAKAKKQTIEAEKLTGD
NIYKVLIYFDKLYKVMNDVERRQLISALISEIQVYEEKQSNGQWLKSITFKLPIIEENLN
IGLDNDEQVECVSLLEKRS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaaaataaaagtatacctctatacacgagtatctacgtcaatacagata
gaggggtattcgttagaggcacaaaaatcacgaatgaaagcttttgctatttacaacgat
tatgaaattgttggagagtatgaagatgccgggaagtctgacaagtctattgaaggtaga
atacagttcaatcgaatgatggaagatataaaatctggaaaagatggagtatcttttgtt
cttgtgtttaagttatcaagatttgcaagaaatgccgctgatgttctttctacacttcat
ataatgcaggattatggagttaatcttatctgcgttgaagatggcattgattcatctaaa
gatgctgggaaactaatgatttctgttttatcagctgtggctgaaatagaaagagaaaac
atcagtattcaaacaatggaaggtcgcattcaaaaagcaggggaaggaaaatggaatggt
ggctttgctccgtatggatataaacttgaagacggcaagctgtttataaatgaggaagag
gcagttgcaataagaacgattttcgaccagtatgtaaatactacgataggagccaatggg
atatctaaatacttagagaatcatggaattagaaaaatcccaagacagaatggtaagaat
cctttgtttgatgcaggtcttataagaaagatattaaagaatcctgtatataatgggaaa
atagcatttggaagaagaactttagaaaaagttcatggtacaagaaatgaatataagcag
gttgaacaagatgaatatctaatatctgaagggatacatgaagctatagtttccgatgaa
gtttggcaagctgctcaggttaagctaaaatctcaagcaaagaaatatgagcatgtgaat
aaaggaaaagatacacgcacacacttgctttctggaattgtaaaatgcccgatatgtgga
gtgggaatgtttgggaacaagtgtatcaagaaaaagaaagatggcacaaagtataaagat
ttttattactatggttgtaaccataggcagatgataagaggtaataagtgtacattcagt
aagcaaattagagaagaattgttagatgatgctgttgcagaggtgattgtcaagatagta
agtaatccgaaatttgcttctatgatgcaagaaaaaatcaacatgaaggtggatacctct
gaaatagaaaaagaaatagataattaccaaaaggaattgagaaagagtcattctacaaag
tttaagctaattgaggaaatagataatttagatgttgaagataagcattataagagaagg
aaacaggatttagatgatagactatatcgtatgtatgacaaactagatgaattagaatca
tcactaattgatgcgaaagcaaagaaacagactattgaagctgaaaagcttacaggagat
aacatatataaggttctgatctattttgataagctctataaagtcatgaatgatgtagag
cgtaggcagttaatttcagctttgatttctgaaattcaagtttatgaagaaaaacaatct
aacggacaatggctaaaatccattacttttaagctaccaattatagaagaaaatctcaac
ataggtttggacaatgatgaacaagttgaatgtgtaagtttattagagaaacgtagttaa

DBGET integrated database retrieval system