KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1041Help
Entry
SP_1041           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAK75156
UniProt: A0A0H2UPT7
Position
981125..981736
Genome map
AA seq 203 aa AA seqDB search
MLIYISLIMKMERLSMVILELYQNDYSKDLVAFDSIEDGKAFVAQIPGYTLETEDGFEVE
YFNPKNIPDYMEIIFNGNIVPLSKFMFDPEENVNIIWKEISNLSLKNDRVIEGYSKIDAY
VVNNHEVKAYVETRETNYRKAKDFLESRGYEIDRSFFGSEDGEAILYRKKGIEVWHFLCH
LDPMFVEIEDVEGYVKEEVGEIQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgcttatttacattagcctgataatgaaaatggagagattatcgatggttatattggaa
ttgtaccaaaatgattattctaaagatttagtagcatttgattccatagaagatgggaaa
gcctttgtagctcaaatcccgggatacactctggaaacagaagatggttttgaagtggag
tattttaatcctaaaaacataccggattatatggaaattatttttaacggaaatattgtt
cctttatctaaatttatgttcgatcctgaggaaaatgtaaacattatttggaaagagatt
tcaaatttatccctcaaaaatgatagagtgatcgaaggatattcaaaaattgatgcatat
gtcgttaacaaccatgaagttaaagcctatgtcgaaacaagagaaacgaactatcgtaaa
gcaaaagacttcttagaaagccgcggatatgaaatcgacagaagctttttcggaagtgaa
gacggtgaagcgattctttacagaaaaaaagggatcgaagtttggcatttcttgtgtcac
ttagacccaatgtttgtagagattgaagatgtagaaggatatgttaaagaagaagttgga
gagattcaatag

DBGET integrated database retrieval system