KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1042Help
Entry
SP_1042           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 DUF3226 AAA_lid_6 Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: AAK75157
UniProt: A0A0H2UPU3
Position
982049..982246
Genome map
AA seq 65 aa AA seqDB search
MMKMATDKNRIMISLDDKNLEKLENLVEDARDRRGMRLTKSQVIELLLNTVDYFDDIMGA
IYSKK
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaatggcaaccgataaaaatagaataatgattagcttggatgataaaaatcta
gagaaacttgaaaatttagtagaagatgctagagatagaaggggaatgcgactaacaaag
tcccaggttattgaattactcctaaataccgttgattatttcgatgatattatgggggct
atttactcaaaaaaataa

DBGET integrated database retrieval system