KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1044Help
Entry
SP_1044           CDS       T00057                                 

Definition
(GenBank) putative hydrolase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-ProteinID: AAK75159
UniProt: A0A0H2UQ12
Position
983124..983978
Genome map
AA seq 284 aa AA seqDB search
MLGAIIGDIVGSVYEWNNIKTKDFPLFRKDCFFTDDTVMTCAVAEAIMNGGQKDDFIDAM
KKYGRMYPNADYGARFNAWLNSDNREPYNSFGNGSAMRISPCAWIMDCGFYAKTGIWPSS
RGLTSLSAEVTHNHPEGVKGAMATADAIFLCRFYFGGYCREYEQSINDNPTECKRRIKDY
IEKEYDYNLSQTLDEIRPNYRFNETCQETVPQAIIAFLESRDFEDAIRNAISLGGDSDTL
AAITCSIAEAAYGIPDWIKDKAYSYLDEPLKDVVRRWENRIKAY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcttggagcaattattggagatattgtcggttctgtttacgaatggaacaatatcaaa
acaaaggactttcctttatttcggaaggactgcttttttacagatgacacggttatgacc
tgtgctgttgcagaagcaattatgaatggtggacaaaaagatgacttcattgacgcgatg
aagaaatatggcagaatgtatccgaatgctgattacggtgctcggtttaatgcatggcta
aacagcgataaccgtgagccttataatagctttgggaatggatcagctatgcgtatttct
ccatgtgcttggatcatggactgtggtttttatgcgaaaactggtatatggccatcatct
agaggacttacgagtctttctgcagaggtaactcataatcatccagaaggtgtcaaaggc
gctatggctacagctgatgctatctttctatgtcgtttttactttggtggttattgtaga
gagtacgagcaatcaattaacgacaatcctacagagtgtaaaagacgaattaaggattat
atagaaaaagaatacgattacaatctatctcaaactttagatgaaatccgtcctaactat
cgttttaacgaaacatgtcaggaaactgtccctcaagccattatcgcctttcttgaaagt
agagacttcgaagatgcgataagaaatgccatctcacttggtggcgacagtgatactctc
gcagcaatcacttgtagcatagcagaggcagcttacggtattcctgattggatcaaggat
aaggcctattcttacttggatgaacccttaaaggatgtagttaggcgatgggaaaataga
ataaaagcgtattaa

DBGET integrated database retrieval system