KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1050Help
Entry
SP_1050           CDS       T00057                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K18830  HTH-type transcriptional regulator / antitoxin PezA
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spn03000]
    SP_1050
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:spn02048]
    SP_1050
Transcription factors [BR:spn03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SP_1050
Prokaryotic defense system [BR:spn02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   PezT-PezA
    SP_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 MqsA_antitoxin Nckap1 HTH_37 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AAK75164
UniProt: Q97QZ2
Structure
PDB: 

Position
988052..988528
Genome map
AA seq 158 aa AA seqDB search
MIGKNIKSLRKTHDLTQLEFARIVGISRNSLSRYENGTSSVSTELIDIICQKFNVSYVDI
VGEDKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSD
LIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattggaaagaacataaaatccttgcgtaaaacacatgacttaacacaactcgaattt
gcacggattgtaggtatttcacgaaatagtctgagtcgttatgaaaatggaacgagttca
gtctctaccgaattaatagacatcatttgtcagaagtttaatgtatcttatgtcgatatt
gtaggagaagataaaatgctcaatcctgttgaagattatgaattgactttaaaaattgaa
attgtgaaagaaagaggtgctaatctattatctcgactctatcgttatcaagatagtcag
ggaattagcattgatgatgagtctaatccttggattttaatgagtgatgatctatctgat
ttgattcatacgaatatctatctagtagaaacttttgatgaaatagagagatatagtggc
tatttggatggaattgaacgtatgttagagatatctgaaaaacggatggtggcctaa

DBGET integrated database retrieval system