KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1051Help
Entry
SP_1051           CDS       T00057                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16214  UDP-N-acetylglucosamine kinase [EC:2.7.1.176]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:spn02048]
    SP_1051
Enzymes [BR:spn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.176  UDP-N-acetylglucosamine kinase
     SP_1051
Prokaryotic defense system [BR:spn02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   PezT-PezA
    SP_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zeta_toxin AAA_33 APS_kinase G-alpha AAA AAA_16 TsaE AAA_24 CPT PRK AAA_17 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AAK75165
UniProt: Q97QZ1
Structure
PDB: 

Position
988528..989289
Genome map
AA seq 253 aa AA seqDB search
MEIQDYTDSEFKHALARNLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQGNI
VIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLRYNLLIEGTLRT
VDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQARATPKEHHDFI
VNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELLFGEWSQVEKEML
QVGEKRLNELLEK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccaagattatactgatagtgaattcaaacatgctttagcaaggaatcttcgt
tcactgacaagaggaaaaaagtccagtaagcaacctatagcgattttgcttggagggcaa
agtggtgccggtaagactacaattcatcgtattaaacagaaagaatttcaaggaaatatt
gttatcatagatggtgatagttttcgttctcagcatccacactatttagaactgcagcaa
gaatatggcaaagacagtgtagaatataccaaagattttgcaggaaaaatggtagagtct
ttagtaacaaaattgagtagtttgagatacaatcttttgatagagggaactttacgaaca
gttgatgttccaaagaaaacagcacaactcttgaaaaataagggatatgaagtacaattg
gccttaattgcgacaaagcctgaattgtcgtatctaagtactcttatccgttatgaagaa
ctgtacattatcaatccaaatcaagcacgcgcaactccaaaagaacatcatgatttcatt
gtaaatcatctagttgataacacacgaaaattggaagaactagctatctttgaaagaatt
caaatttaccaacgagatagaagttgtgtatatgattcaaaagaaaatacaacttcagca
gcagatgttcttcaagagttactctttggggagtggagtcaggtagagaaggagatgttg
caggtgggggaaaagagacttaatgaattacttgaaaaataa

DBGET integrated database retrieval system