KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1054Help
Entry
SP_1054           CDS       T00057                                 

Definition
(GenBank) Tn5252, Orf 10 protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAK75168
UniProt: A0A0H2UQ13
Position
991304..991660
Genome map
AA seq 118 aa AA seqDB search
MKRDVRDIRKQFRLTEAEEKQILALMRERGETNFSDFLRKSLLSSDLQKQMETWFALWQS
QKLEQISRDVHEVLILAQSERQVTQEHVSILLTCVQELIQEVANTIPLSKEFREKYMR
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagatgtgcgtgatattcggaaacaatttcgtttaacagaagcagaagaaaag
caaattctagctttgatgagagagcggggagagactaatttctctgattttcttcgtaaa
agtttactttcctctgatttacaaaaacagatggagacatggtttgccctctggcaatcc
caaaaactagaacaaatcagtcgtgacgttcatgaagttttaatcttggcacagtcagaa
cgtcaagtcacccaagagcatgtatctattctcttaacgtgcgtgcaggaattgattcaa
gaggttgcaaacaccatacccctcagtaaagaatttcgtgagaagtacatgaggtaa

DBGET integrated database retrieval system