KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1055Help
Entry
SP_1055           CDS       T00057                                 

Definition
(GenBank) Tn5252, Orf 9 protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MobC DUF1533 DegS
Motif
Other DBs
NCBI-ProteinID: AAK75169
UniProt: A0A0H2UQ17
Position
991665..992030
Genome map
AA seq 121 aa AA seqDB search
MEHRYRTNLKKVFLSDSELNQLNINIDQSGCKSFSEYARRTLLDPGMNFITIDTNGYQDL
VFELKRIGNNINQIARSVNQSQLISGEELQELKKGIGELIKEVDKEFNLQAQKLKEFHGH
H
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcgttaccgaaccaatctcaagaaagtgtttttgtctgatagtgagttgaac
caactaaatataaatatcgatcaaagtggttgtaaatccttttctgaatatgcgagacga
actctactcgatcctggtatgaattttatcacgattgacacaaacggttaccaagattta
gtgtttgagttaaagaggattggcaataatatcaaccagattgctcgaagtgttaatcaa
tctcagttaatttctggtgaagaattgcaggagttgaaaaaaggaattggtgaattgata
aaagaagttgataaggaatttaatctgcaagcgcagaagctaaaggagttccatggtcat
cactaa

DBGET integrated database retrieval system