KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1056Help
Entry
SP_1056           CDS       T00057                                 

Definition
(GenBank) Tn5252, relaxase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Relaxase Streptin-Immun
Motif
Other DBs
NCBI-ProteinID: AAK75170
UniProt: A0A0H2UPU5
Position
992017..993840
Genome map
AA seq 607 aa AA seqDB search
MVITKHFAIHGKSYRRKLIKYILNPEKTNNLALVSDYGMKNFLDFPSYEEMVQMYHENFI
SNDTLYDFRHDRMEENQRKIHAHHIIQSFSPEDHITPEQINRIGYETVKELTGGKFRFIV
ATHVDKDHLHNHIIINSVDSNSDKKLKWDYKVERNLRMISDRFSKIAGAKIIENRYSHQR
YEVYRKTNHKYELKQRLYFLMEHSRDFEDFKKNAPLLHVEMDFRHKHATFFITDSTMKQV
VRGKQLNRKQPYTEEFFKNYFAKREIESLMEFLLLKVENMDDLLQKAKLFGLTINPKQKH
VSFQFAGVEVKETELDQKNLYDVEFFQDYFKNRKDWQAPETEDFVQLYQEEKLSKEKELP
SDEKFWESYQEFKSNRDAVHEFEVELSLNQIEKVVDDGIYVKVKFGIRQEGLIFVPNMQL
DMEEDKVKVFIRETSSYYVYHKDAAEKNCYMKGRTLIRQFSYENQTIPLRRKATVDMIKE
KIAEVDALIELEVENQSYVTIKDELVHELAASELRINELQERMSTLNQVAEYLLASVESK
QEMKLNLSKLNITENISANIVEKKLKSLGNQLELERGRYEKMVVRLDKFINRLNTGLSKG
DGIDFQK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcactaaacactttgccattcacggaaagagttaccgcagaaagcttatcaag
tacattctcaatcctgagaaaaccaataatcttgccttggtgtcggactatggcatgaag
aattttctggactttcctagctatgaggaaatggtgcagatgtatcatgaaaatttcatc
agcaacgatacgctttacgattttcgccacgacaggatggaagaaaatcaacgaaaaata
cacgctcaccacatcattcagtctttctcgccagaggatcatatcactcctgaacaaatc
aatcggataggttatgagactgtgaaggaattaactggtggcaaatttcgttttatcgtt
gcgacccatgttgataaagaccacctgcacaatcacatcattatcaattcagtagatagc
aattctgacaaaaagctcaagtgggactacaaggtggagcgaaatcttcgcatgatttct
gaccgtttttctaaaatcgcaggtgctaaaatcattgagaaccgctattctcaccagcgg
tatgaagtctatcgtaagactaatcacaagtatgaactcaagcagcgactctattttttg
atggaacattctagggactttgaggatttcaaaaagaatgctccgctactacatgtggag
atggatttccgtcacaagcatgccaccttttttattacggactcaactatgaaacaggtg
gtgcgtggcaagcaactcaatcgcaagcagccttacacagaagaattttttaagaactac
tttgccaaaagagaaatagaaagtctcatggaatttttattgctgaaagttgagaatatg
gatgatttacttcagaaagcaaaactttttggactaactatcaatcctaaacaaaagcat
gtttcttttcaatttgcaggagtggaggtaaaggagacagagctagaccagaaaaatctt
tatgatgtagagtttttccaagattattttaaaaatagaaaagattggcaagctccagaa
actgaggatttcgttcaactttatcaagaagaaaagttatccaaagaaaaagaacttcca
agcgatgagaagttctgggagtcctatcaagagttcaagagtaacagagatgccgttcat
gaatttgaggtggagttgtcactcaatcaaattgaaaaagtagtggatgatggaatttac
gtcaaggtcaagtttggtattcgtcaggagggacttatctttgtgccgaacatgcagctt
gatatggaagaggataaggtgaaggttttcatcagggaaaccagctcctactatgtctac
cacaaagacgctgccgagaaaaattgttatatgaaaggtcgaaccttaattagacagttc
agctatgaaaatcaaaccattccattacgcagaaaagcgacagtcgatatgattaaagag
aagattgcggaagtggatgctttgattgaactggaagtagaaaatcaatcttatgtcacg
attaaagatgagttagtgcatgaactagcagcgtctgaattgagaatcaatgagttgcaa
gaacgaatgtcaaccttgaatcaagtagcagaatatctactggcttcagttgaaagtaag
caagaaatgaaattaaatctttcaaaactgaatataactgagaatatcagtgctaatatt
gttgagaaaaaattgaagagcctggggaatcaactggaattggaaaggggcaggtatgaa
aagatggtagtcaggctagataaatttataaatcgcttaaatacaggactttcaaaagga
gatgggatagattttcaaaaatag

DBGET integrated database retrieval system