KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1057Help
Entry
SP_1057           CDS       T00057                                 

Definition
(GenBank) putative transcriptional regulator PlcR
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 DUF4351 HTH_26 Reoviridae_Vp9
Motif
Other DBs
NCBI-ProteinID: AAK75171
UniProt: A0A0H2UPU6
Position
993954..994820
Genome map
AA seq 288 aa AA seqDB search
MGTLLATRLKNRRKELKMSQRELAEGICKQGQISRLESGEFTPGADFLHALAKKLKVSMD
YFFDEQVVEEVNELSEFKKLAQTFITNRNYESLKYIYELENVKAHRLSLADKFYMEWIKS
LIDFYFYGQKEEAITRLENMLPQLNVSDLNYLQVSNTLFNFYYDIEDLERFNEIRDKLEH
QVNQLNLNTIEELELSIKFNYNVCRYLWLQKNIEEAITKITATIKQCKEYRTTYLLADLY
LLMGSVSENFSSKSSVKEYFETAHFLYKLEENMSMALKVEHYFADITE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgggtacactattagcaacaagattaaaaaatagacgaaaagaattaaaaatgtctcag
cgagaattagctgagggtatctgtaaacaggggcaaattagtcgattagagagtggagag
ttcacccctggagcggattttttacatgcccttgctaagaaattaaaagttagtatggac
tacttttttgatgagcaggttgtagaggaagtcaatgagttatcagagtttaagaagtta
gcacagacatttatcacaaatcgtaattatgaatctttaaaatatatatatgaattggaa
aatgtaaaagcccatcgcttatctctagcagataaattttacatggaatggataaagtct
cttatagatttttatttttatggacagaaagaagaggcaattacacgattagagaatatg
ctacctcagttaaatgtatctgatttgaactaccttcaagtttcaaacactctattcaat
ttttattatgatattgaagatttagaacgttttaatgagattagagacaagctagagcat
caagtgaatcagcttaatttaaacacaattgaagagttagaactatcaattaagttcaat
tataacgtttgtcgatacctatggttacagaaaaatattgaagaagctattacgaaaatc
acagctacgataaagcaatgtaaggagtacaggacaacttatctattagctgatttgtat
ttattgatgggaagtgtaagtgaaaatttttcttctaaaagttcagtaaaagaatatttt
gagactgctcattttctctacaaacttgaggaaaacatgtcaatggctttgaaagtcgaa
cattattttgcagatataacagaataa

DBGET integrated database retrieval system