KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1059Help
Entry
SP_1059           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigA Xylo_C
Motif
Other DBs
NCBI-ProteinID: AAK75173
UniProt: A0A0H2UQ18
Position
995411..995662
Genome map
AA seq 83 aa AA seqDB search
MSSQMKAFLNELQGNMEVVGEFFDNPEKVIRKFGIVGREKEALLIRDLNDMDDYALSIQN
SVASPSGAHSSTCHFVRQDLQSA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtcaaatgaaagctttcttgaatgaacttcaaggaaatatggaagttgttgga
gaattttttgataatcctgaaaaggtaattagaaaatttggaattgtcggaagagagaag
gaagcattgctaatccgtgacttaaatgatatggatgattatgctctttcaattcaaaat
agcgttgcatcgccttctggggcacatagtagcacttgccattttgttagacaagattta
caatccgcataa

DBGET integrated database retrieval system