KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1060Help
Entry
SP_1060           CDS       T00057                                 

Definition
(GenBank) hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAK75174
UniProt: A0A0H2UQ22
Position
995882..996193
Genome map
AA seq 103 aa AA seqDB search
MADMKNKYDVKRIIPDELSESLDIFLKNYSETGLSDYNTYLFYGFILKSYKLPRENRYSI
KLLVKELQNRGLKVTLIINIYYHALNCLALNDGLKIYGEDFLI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
gtggccgatatgaaaaataaatacgatgttaaaagaattattccggatgaattatcagaa
tcactagatatttttctaaaaaattattctgaaactggattgtcagattataatacttat
ctcttttatggttttatcttgaagtcctataaattgcctcgagaaaatagatatagcata
aaattattggtgaaggaattacaaaatagaggactgaaagttacattgattatcaacatt
tattatcacgctttaaattgtttggctttaaatgatggtctaaaaatttatggagaagat
ttcttaatatga

DBGET integrated database retrieval system