KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1061Help
Entry
SP_1061           CDS       T00057                                 

Definition
(GenBank) putative protein kinase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Haspin_kinase RIO1 APH Choline_kinase DUF4135
Motif
Other DBs
NCBI-ProteinID: AAK75175
UniProt: A0A0H2UPU9
Position
996190..997536
Genome map
AA seq 448 aa AA seqDB search
MNYEKYLNYLDYETEIEDAYHNLLLEYKISDNFSDEHWLYNLPSNITQSKGFKIHLSASI
LNANLVAKKFFDFIFSREKKINFKILVSIKELSLQNTGLNGYSQVGKFITIYPKDNKEFQ
RLLHKLEILYKGVKGVNIPSDFRFQLSEVVYYRYGEFVKDSTFKDKRDKKIPSNVNVPIR
DYYIPRYNTIPDQYIILEVISKNAKGGVYKVFNTQKRVYSLLKEASDLSLVDFTNRDSVN
RLINEREILVELEKEEFTPKVFNDFYIKNSYFVEFEFIIADKLSEYNMVSGSYDWFLTLI
DYMEIINSKYNLSYRDLSFNNILIDNRNNIYIIDFEHALRKETQIEEKKLPLFGTPGFYE
TNLNLLNNQPEDIMGLVLLLYWSQNLDDFNVFSKMSFLEAMEYAMNFNSRRLDTLDKSDW
LYDIYKKAFNYKYDTFSELKKDFIEVLK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaaaagtatttaaactatttggactatgaaactgaaatagaagacgcatac
cataatttattattagaatataaaattagtgataattttagtgatgaacattggttatat
aatttgccgtctaatatcacccaatctaagggatttaaaatacacctgagcgcttcaata
ttaaatgctaatttggttgctaaaaaattctttgattttatattttctagagagaagaag
ataaatttcaaaattttggttagcattaaagaactttctttgcaaaatacagggcttaat
ggttattcacaagtcgggaaattcattacaatttatccaaaagataataaagagtttcaa
cgtttgttacacaaattagaaatattgtataaaggtgtaaagggtgtaaacataccatca
gatttcagatttcaacttagcgaggttgtatattacagatatggggagttcgtaaaagat
agcactttcaaggataaaagagataagaaaatcccttcaaatgtgaatgttccaataagg
gattactatattccaagatataacactattcctgatcaatatattattttggaagtgatt
tctaaaaatgccaaaggtggagtttataaagtatttaatactcaaaagcgagtttattct
ttattaaaagaagctagtgatttatcgttggttgattttacaaatagagattctgtgaat
cgtttaataaatgaaagagaaatattagtagaattggaaaaggaggaatttactccaaaa
gtttttaacgatttttacataaagaattcgtattttgtggaatttgagtttattattgca
gataaattaagcgagtataatatggttagtggctcgtatgattggtttttaacattaatt
gattatatggagataataaactccaaatataatctttcctatagagatttatcatttaat
aatatacttattgataatagaaataatatttatattatagactttgagcatgccctaagg
aaagaaactcaaattgaagaaaaaaagttgcctctatttggaactccagggttttatgaa
accaacttaaatttattgaataatcaaccagaggatattatgggattggttttgttatta
tattggagtcagaatttagatgattttaacgtcttttcaaaaatgagttttttagaagcg
atggagtatgcaatgaattttaattcgcgtcgcttagacacacttgataaatcagattgg
ctttatgatatttataaaaaagcgttcaattataaatatgatactttttctgaattaaaa
aaagattttatagaggtattaaaataa

DBGET integrated database retrieval system