KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1062Help
Entry
SP_1062           CDS       T00057                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Module
spn_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1062
Transporters [BR:spn02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254]
    SP_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase MMR_HSR1 AAA_29 DUF3948 Dynamin_N AAA_23 DUF4162 AAA_22 MeaB
Motif
Other DBs
NCBI-ProteinID: AAK75176
UniProt: A0A0H2UPV1
Position
997550..998467
Genome map
AA seq 305 aa AA seqDB search
MNCFLKMNNVSVRYDDVIALKDITLQINKGDFIGLLGSNGAGKSTLINSIVGFQEIYLGE
IEYCDKDLIVSSQPFAHLGFTPQTTVIDFYTTVKDNVILGLNLAGKFGKNAEKLCQIALE
IVGLADKKNNLVETLSGGQLQRVQIARAIAHNPDFYILDEPTVGLDTESAEKFLMYLKDK
SLEGKTIIISSHDINLLEKFCKKILFLQNGSISFFGDMRDFVDNSTIKLNFSMQNRISRY
QIEFLENFRFKVHIEDNDSFTIEVPIEEKILDVINEVGKACEIKNFSTSKLTLQESYLQR
IGGEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtttcttgaaaatgaataatgtaagtgttcgttatgatgacgtaatagcttta
aaagatataactttacaaataaataagggagatttcattggcttattaggttcaaatggt
gcaggtaaatctacgttaattaattctattgtaggttttcaagagatttatttaggagaa
atagagtattgtgataaagatttgatagttagttctcaaccttttgctcatttaggcttt
actcctcaaaccacagtaattgatttttatactactgtgaaggacaatgtaatattgggg
ctgaaccttgctggaaagtttgggaaaaatgctgagaagttgtgtcaaatagccttagaa
attgttgggttagctgataaaaaaaataatttggtagaaacattgtcaggtggacaactg
caacgcgtccagattgctagagcaatagctcataatccagatttttatattttagatgaa
cctaccgttggtttagatactgaatctgccgaaaaatttttaatgtatttaaaagataag
agtttggaaggaaaaactattatcatatcttcacatgacataaatctactcgaaaagttt
tgtaaaaaaatactttttttacaaaatggctccatatcattttttggtgatatgcgtgac
tttgtagataattcaactatcaaattaaatttttcaatgcagaatagaatttctagatat
caaattgaatttttagaaaattttagatttaaagttcacatcgaagataatgatagtttt
acaatagaagtccctatagaagaaaagatcttagatgttatcaatgaggtaggaaaagca
tgtgaaattaaaaacttttcaacaagtaaattaaccttacaagaaagttatttgcaaaga
ataggaggagaaaaatga

DBGET integrated database retrieval system