KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1063Help
Entry
SP_1063           CDS       T00057                                 

Definition
(GenBank) putative ABC-2 transporter, permease protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Module
spn_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:spn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1063
Transporters [BR:spn02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254]
    SP_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: AAK75177
UniProt: A0A0H2UPV9
Position
998464..999264
Genome map
AA seq 266 aa AA seqDB search
MKADQLRHKSDLGLRGLAIIAKNEIIAFFRSKGLIISQFLQPILYVVFIIIGLNSSIKNI
QFNDIKTSYAEYTIIGVIALLIIGQMTQVIYRVTIDKKYGLLALKLCSGVRPLYYILGMS
IYSILGLIVQEIIIYIITLAFEINIAMDRFFYTVLLSIVVLLFWDSLAILLTMFINDYRR
RDIVIRFVLTPLGFTAPVFYLIDSAPSIVRWIGQLNPLTYQLTILRNFYFKNSTTLELVF
LLLTSLLVLISVSFIIPKIKLILIER
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgatcaattaaggcacaaatcggacttaggtttaagaggtctagcgattatt
gctaaaaatgagattattgctttttttagaagtaaaggtttaattatttctcagtttcta
caaccaatcttatatgttgtttttataataataggattaaattcttcgataaagaacatt
cagtttaatgatataaaaacctcttatgcagaatatacaatcattggtgttatagcttta
ttgataatcgggcagatgactcaagttatttatagggtgacaatagataaaaaatatggg
ctacttgctcttaagttatgcagtggagttcgtcctttatattatattttagggatgagt
atctattctatattagggttgatagttcaagaaattattatatatataattacgttagcg
tttgagataaatatcgcaatggatagatttttttatacagttttgttatctattgttgtt
ttattattttgggactcccttgcaattttacttacaatgtttatcaatgattacagaaga
cgtgatattgtaatacgttttgtactaacaccgcttggttttacagctcctgttttctac
ttaatagattctgctcctagtattgtgagatggattggtcagttaaatcccttaacttat
caattaactattttgagaaacttttattttaaaaattcaacaactttggaattagttttc
ttattgttaacatcattacttgtccttatatctgtatcttttattataccaaagataaaa
ttgatactgatagaaagataa

DBGET integrated database retrieval system