KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1064Help
Entry
SP_1064           CDS       T00057                                 

Definition
(GenBank) transposase, IS200 family
  KO
K07491  putative transposase
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    SP_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Y1_Tnp EFG_C
Motif
Other DBs
NCBI-ProteinID: AAK75178
UniProt: A0A0H2UQ23
Position
999422..999895
Genome map
AA seq 157 aa AA seqDB search
MREDNQSLSHTTWNCKYHIVFAPKYRRQIIYGRYKASIGRIIRDLCERKGVIIHEANACS
DHIHMLISIPPKLSVSSFMGYLKGKSSLMIFDKHANLKYKYGNRKFWCRGYYVDTVGRNQ
KVIAEYIQNQLQEDRVADQLTLFESVDPFTGEINKRK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggataatcaaagtttatcacataccacatggaattgtaaatatcatattgtt
tttgcacccaaatatcgtcgtcaaatcatttatggcagatacaaagctagtatcggaaga
atcatacgtgacttatgtgagcgtaagggtgtaataatccatgaagcgaatgcttgttca
gaccatattcacatgcttatcagtattcctccgaaacttagtgtttcgtcctttatgggc
tatttaaagggcaagagcagtttgatgatttttgataagcatgcgaatttaaaatacaaa
tatggcaatcgcaagttttggtgtagaggctattatgtagatacggtaggccgtaatcag
aaagtgatagctgaatatattcagaatcaattacaagaagacagagtagcagaccagctc
acgttattcgagtcagtagatccgtttactggcgaaataaataagaggaagtaa

DBGET integrated database retrieval system