KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1560
Entry
SP_1560           CDS       T00057                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
SSDB
Motif
Pfam: YbbR
Other DBs
NCBI-ProteinID: AAK75647
UniProt: A0A0H2UQV5
Structure
PDB: 
4QDY

Position
complement(1469414..1470193)
AA seq 259 aa
MKKNSLYIISSLFFACVLFVYATATNFQNSTSARQVKTETYTNTVTNVPIDIRYNSDKYF
ISGFASEVSVVLTGANRLSLASEMQESTRKFKVTADLTDAGVGTIEVPLSIEDLPNGLTA
VATPQKITVKIGKKAQKDKVKIVPEIDPSQIDSRVQIENVMVSDKEVSITSDQETLDRID
KIIAVLPTSERITGNYSGSVPLQAIDRNGVVLPAVITPFDTIMKVTTKPVAPSSSTSNSS
TSSSSETSSSTKATSSKTN
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatagtttatatatcatatcctcactcttttttgcttgtgtcttatttgtc
tatgctacggcgacgaattttcaaaacagtaccagtgctaggcaggtaaaaacggaaacc
tatactaatacagtaacaaatgtccctattgacatacgctataatagtgataagtatttt
attagcggttttgcttcagaagtatcagtggtcttgactggtgcaaatcgcctatcgcta
gctagtgaaatgcaagaaagtacacgtaaattcaaggttactgctgacctaacagatgcc
ggtgttggaacgattgaagttcctttgagcattgaagatttacccaatgggctgaccgct
gtggcgactccgcaaaaaattacagtcaagattggtaagaaggctcagaaggataaggta
aagattgtaccagagattgaccctagtcaaattgatagtcgggtacaaattgaaaatgtc
atggtgtcagataaagaagtgtctattacgagtgaccaagagacattggatagaattgat
aagattatcgctgttttgccaactagcgaacgtataacaggtaattacagtggttcagta
cctttgcaggcaatcgaccgcaatggtgttgtcttaccggcagttatcactccgtttgat
acaataatgaaggtgactacaaaaccagtagcaccaagttcaagcacatcaaattcaagt
acaagcagttcatcggagacatcttcgtcaacgaaagcaactagttcaaaaacgaattaa

DBGET integrated database retrieval system