KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1880Help
Entry
SP_1880           CDS       T00057                                 

Definition
(GenBank) HAM1 protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:spn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SP_1880
Enzymes [BR:spn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     SP_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAK75952
UniProt: P64310
Position
complement(1782405..1783007)
Genome map
AA seq 200 aa AA seqDB search
MLIATRNEGKTKEFRAIFDKLGYDVENLNDYPDLPEVAETGMTFEENARLKAETISQLTG
KMVLADDSGLKVDVLGGLPGVWSARFAGVGATDRENNAKLLHELAMVFELKDRSAQFHTT
LVVASPNKESLVVEADWSGYINFEPKGENGFGYDPLFLVGETGESSAELTLEEKNSQSHR
ALAVKKLLEVFPSWQSKPSL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgttgattgcgactcgtaacgaaggtaaaaccaaggaattccgagctatctttgataag
ttaggctacgatgtggaaaatcttaatgactaccctgacctgcctgaagtagcagaaaca
ggtatgacctttgaagaaaatgcccgccttaaggcagaaaccatttctcaattaacgggc
aagatggttttggcagatgattctggtctcaaagtcgatgtccttggtggcttaccaggc
gtctggtcagctcgtttcgcaggtgtgggagcaactgaccgtgaaaataatgccaaactc
ttgcacgaattggccatggtctttgaactcaaggaccgctcggctcagttccacacaacc
ctagtcgtagccagcccaaataaggaaagtttagttgttgaagcagactggtcaggttat
attaactttgaacctaagggtgaaaatggctttggctatgatcccctcttccttgtagga
gaaacaggtgagtcatcagctgaattaaccctggaagaaaaaaatagtcaatctcaccgt
gccttagccgttaagaaacttttggaggtatttccatcatggcaaagcaaaccatcattg
taa

DBGET integrated database retrieval system