KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1887
Entry
SP_1887           CDS       T00057                                 

Gene name
amiF
Definition
(GenBank) oligopeptide ABC transporter, ATP-binding protein AmiF
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn01501  beta-Lactam resistance
spn02010  ABC transporters
spn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:spn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SP_1887 (amiF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SP_1887 (amiF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SP_1887 (amiF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_1887 (amiF)
Transporters [BR:spn02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    SP_1887 (amiF)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_22 AAA_29 Strep_SA_rep AAA AAA_16 AAA_33
Other DBs
NCBI-ProteinID: AAK75958
UniProt: P18766
Position
complement(1791100..1792026)
AA seq 308 aa
MSEKLVEIKDLEISFGEGSKKFVAVKNANFFINKGETFSLVGESGSGKTTIGRAIIGLND
TSNGDIIFDGQKINGKKSREQAAELIRRIQMIFQDPAASLNERATVDYIISEGLYNHRLF
KDEEERKEKVQNIIREVGLLAEHLTRYPHEFSGGQRQRIGIARALVMQPDFVIADEPISA
LDVSVRAQVLNLLKKFQKELGLTYLFIAHDLSVVRFISDRIAVIYKGVIVEVAETEELFN
NPIHPYTQALLSAVPIPDPILERKKVLKVYDPSQHDYETDKPSMVEIRPGHYVWANQAEL
ARYQKGLN
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtctgaaaaattagtagaaatcaaagatttagaaatttccttcggtgaaggaagtaag
aagtttgtcgcggttaaaaatgctaacttctttatcaacaagggagaaactttctcgctt
gtaggtgagtccggtagtgggaaaacaactattggtcgtgctatcatcggtctaaatgat
acaagtaatggagatatcatttttgatggtcaaaagattaatggtaagaaatcgcgtgaa
caagctgcggaattgattcgtcgaatccagatgattttccaagaccctgccgcaagtttg
aatgaacgtgcgactgttgattatattatttctgaaggtctttacaatcaccgtttattt
aaggatgaagaagaacgtaaagagaaagttcaaaatattatccgtgaagtaggtcttctt
gctgagcacttgactcgttaccctcatgaattctcaggcggtcaacgtcaacgtatcggt
attgcccgtgccttggtcatgcaaccagactttgttattgcagatgagccaatttcagcc
ttggacgtttctgtacgtgcccaagtcttgaacttgctcaaaaaattccaaaaagagctc
ggcctgacctatctcttcatcgcccatgacttgtcggttgttcgctttatttcagatcgt
atcgcagttatttacaagggtgttattgtagaggttgcagaaacagaagaattgtttaac
aatccaattcacccatatactcaagccttgctttcagcggtaccaatcccagatccaatc
ttggaacgtaagaaggtcttgaaggtttacgatccaagtcaacacgactatgagactgat
aagccatctatggtagaaatccgtccaggtcactatgtttgggcgaaccaagccgaattg
gcacgttatcaaaaaggactaaactag

DBGET integrated database retrieval system