KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_2162
Entry
SP_2162           CDS       T00057                                 

Name
(GenBank) PTS system, IIC component
  KO
K02795  mannose PTS system EIIC component
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00051  Fructose and mannose metabolism
spn00520  Amino sugar and nucleotide sugar metabolism
spn01100  Metabolic pathways
spn02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:spn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SP_2162
   00520 Amino sugar and nucleotide sugar metabolism
    SP_2162
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SP_2162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spn02000]
    SP_2162
Transporters [BR:spn02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    SP_2162
SSDB
Motif
Pfam: EII-Sor
Other DBs
NCBI-ProteinID: AAK76216
UniProt: A0A0H2US88
Position
complement(2080417..2081190)
AA seq 257 aa
MLFTQALLVTLVGIIATIDYNGPLFMIHRPLVTSAMVGLVLGDFTQGVLIGSALELTWLG
VTGIGGYTPPDTISGAIIGTAFGILSGQGETAGIAIAVPIAVATQQLDVLAKTLDVYFVK
KADNDAKNGDYSKIGFYHYSSLVLITLFKIVPIFLAIMLGGEYVADLFAKVPPIVMQGLN
SAGALLPSIGFGMLLNMMLKKNMWVFLLIGFICSVYGGMSTIGISLVGIAVAYFYDMIGS
KPQETTSSSDVEEDLDL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgctattcacacaagcattactggtgacattagttgggattattgccactattgactat
aatggaccgttatttatgattcaccgtccgttagttacaagtgcaatggttggcttagta
ttaggagatttcacccaaggtgttcttattggttcagctcttgaattaacttggctcggt
gtaacaggtattggaggttatactccaccagatactatttcaggtgcgattattggtact
gcatttggtattttatctggtcaaggagaaactgctggtatcgctatagcagttccaatt
gcagttgctacccaacagttggatgttcttgcaaaaactttagatgtttattttgtgaaa
aaagctgataatgatgctaaaaacggagattattcaaagatcggtttttatcattattca
agtttggttttaatcacgttatttaaaattgtaccaattttcctagctattatgcttgga
ggggaatatgtggcagacttgtttgctaaggttccaccaatcgttatgcagggacttaac
tctgcaggtgctttactaccttcaattggttttggtatgcttttaaatatgatgctcaag
aaaaatatgtgggtattcttgttgattggattcatttgttctgtgtatggaggaatgtca
accattgggatctcactagttggtattgcggtagcatacttctacgatatgattggaagc
aaaccacaagaaacaacttcaagtagtgatgttgaggaggatcttgatctatga

DBGET integrated database retrieval system