KEGG   Streptococcus pneumoniae SPN034156: SPN034156_09410Help
Entry
SPN034156_09410   CDS       T02628                                 

Gene name
malQ
Definition
(GenBank) putative 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spne  Streptococcus pneumoniae SPN034156
Pathway
spne00500  Starch and sucrose metabolism
spne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spne00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPN034156_09410 (malQ)
Enzymes [BR:spne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SPN034156_09410 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CCP36610
Position
complement(971606..973123)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGATSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLEASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEHFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSVTGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEDLGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVVHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVDLKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctcttccaggagcttacgga
atcggatcatttggtcaaagtgcttacgacttcgttgatttcttggtccgtacaaaacaa
cgttactggcaaatccttccattaggagcaactagttacggggattctccttaccaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttggaagcaagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaaaatctactatgcacgtcgtcctcttttagaaaaagcggtgaaacgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagcattttgacaatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacatcgaaatcgttggggacatgccaatctacgta
gcggaagattcaagtgatatgtgggcaaatccacatctcttcaaaacagatgtcaatggt
aaggctacttgtatcgcaggatgcccaccagatgagttttctgtaactggtcagctttgg
ggtaatccaatctatgactgggaagcaatggacaaagacggctacaaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgatatcgttcgtatcgaccacttccgtggcttc
gaatcttactgggaaatccctgctggttccgatacagcagcacctggtgagtgggtgaaa
ggtccaggctacaagctttttgcagccgttaaggaagaccttggtgagctaaacatcatc
gcagaagaccttggcttcatgacagatgaagtgatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcattgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgagattgatgatgcgactcgtgagtacatggctcgttacacgaac
cgtaaagaatacgaaacagtggtacacgctatgcttcgtacagtattttcatcagttagc
tttatggcaattgcaactatgcaagatttactagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatttatcgccgaattaatgaaaatttg
gtagatttaaagaaataa

DBGET integrated database retrieval system