KEGG   Streptococcus pneumoniae SPN034156 (serotype 3): SPN034156_09760Help
Entry
SPN034156_09760   CDS       T02628                                 

Gene name
arcB
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
spne  Streptococcus pneumoniae SPN034156 (serotype 3)
Pathway
spne00220  Arginine biosynthesis
spne01100  Metabolic pathways
spne01110  Biosynthesis of secondary metabolites
spne01130  Biosynthesis of antibiotics
spne01230  Biosynthesis of amino acids
Module
spne_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:spne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SPN034156_09760 (arcB)
Enzymes [BR:spne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SPN034156_09760 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N IFRD
Motif
Other DBs
NCBI-ProteinID: CCP36645
Position
1012331..1013347
Genome map
AA seq 338 aa AA seqDB search
MTNSVFQGRSFLAEKDFTRAELEYLIGLSAHLKDLKKRNIQHHYLAGKNIALLFEKTSTR
TRAAFTTAAIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDGIEFRGFSQRMVEELA
EFSGVPVWNGLTDEWHPTQMLADYLTVQENFGRLEGLTLVYCGDGRNNVANSLLVTGAIL
GVNVHIFSPKELFPEKEIVELAEGFAKESGAHVLITEDADEAVKDADVLYTDVWVSMGEE
DKFAERVALLKPYQVNMDLVKKAGNENLIFLHCLPAFHDTHTVYGKDVAEKFGVEEMEVT
DEVFRSKYARHFDQAENRMHTIKAVMAATLGNLYIPKV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattcagtattccaaggacgcagcttcttagcagaaaaagactttacccgtgca
gagttagaataccttattggtctttcagctcacttgaaagatttgaaaaaacgcaatatt
caacaccactaccttgctggcaagaatatcgctctcctatttgaaaaaacatctactcgt
actcgtgcagcctttacaactgcggctatcgaccttggtgctcacccagaatacctcgga
gcaaatgatattcagttgggtaaaaaagaatctactgaagatactgctaaagtattggga
cgtatgtttgacgggattgaattccgcggattcagccaacgtatggttgaagaattggca
gaattctcaggcgttccagtatggaacggtctaactgacgaatggcacccaactcaaatg
ctcgctgactacttgactgttcaagaaaacttcggtcgcttggaaggcttgacattggta
tactgtggtgatggacgtaacaacgttgccaacagcttgctcgtaacaggtgctatcctt
ggtgtcaatgttcacatcttctcaccaaaagaactcttcccagaaaaagaaatcgttgaa
ttggcagaaggatttgctaaagaaagtggcgcacatgttctcatcactgaagatgctgat
gaagcagttaaagatgcagacgttctttacacagacgtttgggtatcaatgggtgaagaa
gacaaattcgcagaacgtgtagctcttcttaaaccttaccaagtcaatatggacttagtt
aaaaaagcaggcaatgaaaacttgatcttcctacactgcttgccagcattccacgatact
cacactgtttatggtaaagacgttgctgaaaaatttggtgtagaagaaatggaagtaaca
gacgaagtcttccgcagcaagtacgctcgccacttcgatcaagcagaaaaccgtatgcac
actatcaaagctgttatggctgctacacttggtaacctttatattcctaaagtataa

DBGET integrated database retrieval system