KEGG   Streptococcus pneumoniae gamPNI0373 (virulent serotype 1): HMPREF1038_00949Help
Entry
HMPREF1038_00949  CDS       T02334                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spng  Streptococcus pneumoniae gamPNI0373 (virulent serotype 1)
Brite
KEGG Orthology (KO) [BR:spng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spng03009]
    HMPREF1038_00949
Enzymes [BR:spng01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HMPREF1038_00949
Ribosome biogenesis [BR:spng03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HMPREF1038_00949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AFS43007
Position
866953..867840
Genome map
AA seq 295 aa AA seqDB search
MEIKIETGGLRLDKALSDLTELSRSLANEQIKSGQVLVNGQVKKAKYTVQEGDVVTYHVP
EPEVLEYVAEDLPLEIVYQDEDVAVVNKPQGMVVHPSAGHTSGTLVNALMYHIKDLSGIN
GVLRPGIVHRIDKDTSGLLMIAKNDDAHLALAQELKDKKSLRKYWAIVHGNLPNDRGVIE
APIGRSEKDRKKQAVIAKGKPAVTRFHVLERFGDYSLVELQLETGRTHQIRVHMAYIDHP
VAGDEVYGPRKTLKGHGQFLHAKTLGFTHPRTGKTLEFKADIPEIFKETLERLRK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaattgaaactggtggtctgcgtttggataaggctttgtcagatttgaca
gaattatcacgcagtcttgcgaatgaacaaattaaatcaggccaggtcttggtcaatggt
caagtcaagaaagctaaatacacagtccaagagggtgatgtcgtcacttaccatgtgcca
gaaccagaggtattagagtatgtggctgaggatcttccgctagaaatagtctaccaagat
gaggatgtggctgtcgttaacaaacctcagggaatggttgtgcatccgagtgctggtcat
actagtggaactctagtcaatgccctcatgtatcatattaaggacttgtctggtatcaat
ggggttctgcgtccgggaattgttcaccgtattgataaggatacgtcaggtcttctcatg
attgctaaaaacgatgatgcgcatctagcacttgcccaagaactcaaggataaaaagtct
ctccgcaaatattgggcgattgttcatggaaatctgcctaatgatcgtggtgtaattgaa
gcgccgattggccggagtgaaaaagaccgtaagaaacaggctgtaattgctaaagggaag
cctgcagtgacgcgttttcatgtcttggaacgctttggcgattatagcttagtagagttg
caactggagacagggcgcactcatcaaatccgtgtccacatggcttatatcgaccatcca
gtcgctggtgatgaggtctatggtcctcgcaagactttgaaaggacatggacaatttctt
catgccaagactttaggttttactcatccgagaacaggtaagaccttggaatttaaagca
gatatcccagagatttttaaggaaaccctggagagattgagaaagtaa

DBGET integrated database retrieval system