KEGG   Streptococcus pneumoniae SPN994038 (serotype 3): SPN994038_09970Help
Entry
SPN994038_09970   CDS       T02630                                 

Definition
(GenBank) putative RNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spnm  Streptococcus pneumoniae SPN994038 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spnm03009]
    SPN994038_09970
Enzymes [BR:spnm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SPN994038_09970
Ribosome biogenesis [BR:spnm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SPN994038_09970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4_2
Motif
Other DBs
NCBI-ProteinID: CCP30733
Position
1003097..1003993
Genome map
AA seq 298 aa AA seqDB search
MRFEFIADEHVKVKTFLKKHEVSKGLLAKIKFRGGAILVNNQPQNATYLLDVGDYVTIYI
PAEEGFETLEAIEHPLDILYEDDHFLVLNKPYGVASIPSVNHSNTIANFIKGYYVKQNYE
NQQVHIVTRLDRDTSGLMLFAKHGYAHARLDKQLQKKSIEKRYFALVKGDGHLEPEGEII
APIARDEDSIITRRVAKGGKYAHTSYKIVASYGNIHLVYIHLHTGRTHQIRVHFSHIGFP
LLGDDLYGGSLEDGIQRQALHCHYLSFYHPFLEQDLQLESPLPDDFSNLITQLSTNTL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgaatttatcgcagatgaacatgtcaaggttaagacctttttaaaaaagcac
gaggtttctaagggattgctggctaagattaagtttcgaggtggagctattctggtcaat
aatcaaccgcaaaatgcaacgtatctattggacgttggagactacgttaccatttacatt
cccgctgaggaaggctttgaaaccttggaggctattgagcatccattagatattctctat
gaggatgaccactttctagtcttgaataaaccctatggagtggcttctattcctagtgtc
aatcactctaataccattgccaattttatcaagggttactatgtcaagcaaaattatgaa
aatcagcaggttcacattgttaccagactagatagggacacttctggcttgatgctcttt
gccaagcacggttatgcccatgcacgattagacaagcagttgcagaagaaatctatcgag
aaacgctactttgctttggttaagggagatggacatttggagccagaaggggaaattatt
gctccgattgcgcgtgatgaagattccattattaccagacgagtggctaaaggcggaaag
tatgcccatacttcatacaagattgtagcttcttatggaaatattcacttggtctatatt
cacctgcacactggtcgaacccatcaaatccgagtccatttttctcatatcggttttcct
ttgctgggagatgatttgtatggtggtagtctggaagatggtattcaacgtcaggctctg
cattgccattacctatccttttatcatccatttttagagcaagacttgcagttagaaagt
cccttgccggatgatttcagtaaccttattacccagttatcaactaatactctataa

DBGET integrated database retrieval system