KEGG   Streptococcus pneumoniae SPN994038: SPN994038_18980Help
Entry
SPN994038_18980   CDS       T02630                                 

Definition
(GenBank) Alpha galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
spnm  Streptococcus pneumoniae SPN994038
Pathway
spnm00052  Galactose metabolism
spnm00561  Glycerolipid metabolism
spnm00600  Sphingolipid metabolism
spnm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPN994038_18980
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPN994038_18980
   00600 Sphingolipid metabolism
    SPN994038_18980
Enzymes [BR:spnm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SPN994038_18980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: CCP31634
Position
complement(1943219..1945435)
Genome map
AA seq 738 aa AA seqDB search
MTIYINKDETVFHLAMKDSSYIFRILENGELQHLHFGKRIHVKENYNQLMAYKKRGFEVS
FSEEFEDIQQSMIQNEYSSYGKGDFRHPAFQVQGMNGSRITTLKYQGFELEKGKNRLNSL
PSTFDDIGQCAETLTIILTDSILDLTVRLNYTIFPEYNVLVRNTEFLNNSNNKLTLLKAM
SLQLDLPDSQYDFIQFSGAWLRERQLYRTSLRPGIQAIDSLRYSSSPQQNPFFMLSRRET
TEHSGEVYGFNFIYSGNFQNMIEVDHFDTARVTVGINPVEFRFLLNPAESFVTPEAIVIY
SDQGMNQMSQQLSDFYRHHLVNPNFSQASRPIILNSWETFYFDLGTEKILDLAKAAKDLG
IELFVLDDGWFGHRKDDKSSLGDWVTDRSRLPEGIGFLADEIHKIGLQFGLWFEPEMISI
DSDLYKNHADWTIHLLDREKSVGRNQYVLDLTRQEVVDYLFDSISKIIIKTNLDYIKWDM
NRHITDIYSIELDSEQQMEFGHRYILGLYQLLDRLITKFPSVLFESCSSGGGRFDLGLMY
YAPQAWTSDDTDPIERLKIQHGTSYGYSPSMMTAHVSISPNEQSGRQTSLDTRTNVAYFS
SFGYELDVTRLSVEEKEQVREQIQFYKKYRSLFQYGDFYRINSPFSCDSASWQVVSKDKC
QSILLYAQLNSKLNPGYTRVYFSGLDKDKCYSVSRFDEFFYGDELMNAGIKVSLSNLALC
VPEYLTKLFVIEEVVCKY
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatattaataaggacgagaccgtttttcatttggcaatgaaagatagtagt
tatatttttagaattttagaaaatggggaacttcaacatctacattttgggaaaaggatt
catgtcaaggaaaattataaccaattgatggcctataaaaaaagaggatttgaagtatct
ttttctgaagaatttgaggatattcaacagtctatgatacaaaatgaatattcttcatat
gggaaaggagattttcggcatccagcctttcaagttcaaggaatgaatggtagtaggata
acgacactaaaatatcaaggttttgaacttgaaaaagggaaaaatcgtcttaactctcta
ccttcaacatttgatgatattggtcagtgtgcggaaacattaacgattattttaacagat
tccatattagatttaactgttagactaaattacacaatttttccggaatacaatgtctta
gttagaaatacggaatttttaaataatagcaataataagttgactcttttgaaagcaatg
agcttacagctagatctacctgatagtcaatatgactttattcaattttctggagcatgg
ctgagggaacgtcagttatatagaacttcgcttagaccaggtattcaagcaatagatagc
ttgagatactcatcaagtcctcagcaaaatcctttctttatgctatcaaggagggaaact
acagagcatagtggtgaggtttatggttttaactttatctattctggaaattttcaaaat
atgattgaagttgaccattttgacaccgctagagtaacggtaggaataaatccagtagaa
tttcgttttttattaaatcctgccgaaagttttgtgacaccagaagcaattgtgatctat
tctgatcaagggatgaatcagatgagccaacaactatcagatttttatcgacatcattta
gttaatcctaatttttctcaagctagtcgtcctataatactcaatagttgggaaacattt
tattttgacttgggtacagaaaaaattttagatttagcaaaggctgctaaagatttagga
atagaattatttgtactggatgatggttggtttggtcataggaaagatgacaaaagttct
ctgggggattgggtaacagatagaagtcgccttcctgaaggtattggatttcttgcagat
gaaattcacaaaataggtttacaatttggtttgtggtttgagcctgaaatgatttctatt
gatagtgatttgtacaagaatcatgccgattggactatccatttgttagacagagagaag
tcagtaggaagaaatcaatatgtgttggatttgacgagacaggaagttgttgattacctt
tttgattctatttctaaaatcataatcaaaacaaatctggattatatcaaatgggatatg
aatcgtcatataacagatatttatagtattgaacttgattctgaacagcagatggaattt
ggtcatcgatatatcttaggtctttatcagttattagatcgtttaataactaagttccct
tcagttctatttgaatcttgttcttcaggtggtggacgttttgatttaggacttatgtat
tatgcaccgcaagcgtggacgagtgatgatacggacccgatagaaagattgaaaattcag
catggaacttcttatggatattctccatcaatgatgacagcccatgtttctatttctcca
aatgaacaaagtggaagacaaacgagtttggacactaggacaaatgtagcttattttagt
tctttcggttatgaattagatgttacgagattgtcggtagaagaaaaagaacaagtgaga
gaacaaattcagttttataaaaaatatcgttcattgtttcaatatggggatttctatagg
ataaacagtccttttagttgtgattctgctagttggcaagttgtttcaaaagataaatgc
caatcgattttattgtatgctcaattgaatagtaagttgaatccaggttatacaagagtt
tattttagtggtttagataaagataaatgctattccgtctctagatttgatgagttcttt
tatggagatgaattaatgaatgctggaataaaagtcagtttaagtaatttagcactttgt
gttccagaatatcttacaaaattatttgttattgaagaagttgtatgtaaatattga

DBGET integrated database retrieval system