KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_02110Help
Entry
T308_02110        CDS       T02890                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    T308_02110
Enzymes [BR:spnn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     T308_02110
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     T308_02110
    1.1.1.-  
     T308_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGZ47232
Position
complement(393286..394329)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLHEFLDGPIFIPTDEHV
YSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNNLVGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSSLKAGDTAVVFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGETAVEAIHRLTNGGVDV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEDFIELTQDKSQIKILVEPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgaaggcagctcgctggcatgcagcgaaagatgttcgtattcaagaaata
gaagttcctgaagtacttccgcaccaagtaaaagttgcagttaagttcacaggaatttgt
ggtactgacctccatgaatttttagatggacctatctttatcccaacagatgagcacgtc
tattctggtcaaaaagcaccggtaacactgggacatgaattttctggtgaaatcatagaa
gtcggaagcgatgttacccgtgttaaagttggtgatcgtgttgctgtggaaccaattcta
gctaaaaataacttagttggtgattataatttggatccaaaccttaattttgtcggtttg
gctgcagacggtggatttgccaaatattgtgttttagacggtgacttagtacatgtcatt
ccagatagtttgagctatgagcaagctgctcttactgaacccgctgctgttgcagtctat
gctgttcgtcaatcttctttgaaggctggcgatacagctgttgtctttggtttaggcccg
attggtctattaattgtagaagctcttcgtgcagctggtgcttctaagatttatgctgtt
gaactatcacctgaacgtcaagcaaaagctgaagagttaggagctatcgttgtccgtccg
gaagaaggtgaaacagctgttgaagctattcatcgtttaacaaacggtggtgtagatgtt
tcttatgaagtaacgggtgtgccagtagttttaggacaagccttagctgccgtacataaa
gcaggtgagtgcatggtggtctctatctgggaacgagaagcaaatattaatccgaatgaa
tttgcaatccaagaaaagacactaaaaggaatcattgcttatcgtcatatcttccctaaa
gtattagaattgatggaacaaggctacttctctgctgaaaaattagttactaagaaaatt
aaattggaaaatatcgtcgaagaagactttatcgaattaactcaagataagtcacaaatt
aaaattttggtagaaccagaataa

DBGET integrated database retrieval system