KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_03380Help
Entry
T308_03380        CDS       T02890                                 

Definition
(GenBank) TenA family transcriptional regulator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00730  Thiamine metabolism
spnn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    T308_03380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spnn03000]
    T308_03380
Enzymes [BR:spnn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     T308_03380
Transcription factors [BR:spnn03000]
 Prokaryotic Type
  Other transcription factors
   Others
    T308_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 RXLR_WY
Motif
Other DBs
NCBI-ProteinID: AGZ47455
Position
662819..663511
Genome map
AA seq 230 aa AA seqDB search
MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLAD
KTSNQEMKRLLKQNAQGLVEGELFIRQQFFKEMEISDQEMEQHPIAPTCYHYISHIYRQF
AEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVN
QLYRESDETDKQKMLDAFYISVHMEAKFWEMAYQHQTWKSDLQSLEKGEE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaatttacagatattgcgatggaattatccaagaaagcttggcaggcttcctttcat
catccctttattttacaattacaagaggggaatttagaacctgccattttccgctattac
ctgattcaggatgcctactatctgaaggccttctcagaaatctatcatcttttggctgat
aagacttcaaaccaagagatgaaaagactcttgaaacaaaatgctcagggtttagtggag
ggtgagttatttattcgccaacaatttttcaaggaaatggaaatcagcgaccaggaaatg
gagcaacatccaattgctccaacctgttatcattacatttctcatatttataggcaattt
gcagaaccgaacttagccatcgcttttgcaagcttgcttccttgtccttggttataccat
gatataggcaaatcacttaatcttaaaccatcaccaaatcctctctatcaacaatggatt
gaaacttatattacggatgagttagagcaacagatcagagaggagggagcactggtcaat
cagctctatcgagaaagtgacgagacagacaagcaaaaaatgctagatgccttctacatc
agtgttcatatggaagccaagttttgggaaatggcctaccaacaccagacatggaagagc
gatttacagtctttagaaaaaggagaagaatag

DBGET integrated database retrieval system