KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_03995Help
Entry
T308_03995        CDS       T02890                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00627  Aminobenzoate degradation
spnn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    T308_03995
Enzymes [BR:spnn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     T308_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AGZ47565
Structure
PDB: 

Position
774554..775327
Genome map
AA seq 257 aa AA seqDB search
MKYKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNTTRTPESVKEMLAQNF
NIDTPLSTVYTATLATIDYMNDLGLEKTVYVVGEAGLKEAIKAAGYVEDKENPAYVVVGL
DWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGTGSLITLLEVATRVKPVYIG
KPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVAGLPI
APTHVVSSLAEWDFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaggctatttaattgatttagacggaaccatttataaggggaaagaccga
atccctgctggagagacttttgttcatgaattgcaaaagcgggacattccctatctcttt
gtaaccaacaatacaacccgcactccagagagtgttaaggagatgttggctcagaatttt
aatatcgatacgcctctatcgactgtctacacagcgactttggcaaccatcgactatatg
aatgatttggggcttgaaaagactgtctatgtcgtcggagaagcaggactcaaggaagcc
atcaaggcggctggttatgtggaagacaaggaaaaccctgcctacgtggtagttggtctg
gattggcaagtcgactatgaaaaatttgccacagcaactcttgctattcaaaagggtgcc
cattttatcggaaccaatcctgacctcaacatcccgacggaacgtggtcttttgccaggt
actggctcactgattacgctgcttgaagtagcgacacgagtgaagccggtttatatcgga
aaaccaaatgccatcattatggacaaggcggttgagcacttaggtttggaacgtgaagag
ttaatcatggttggggacaattatttgactgatatccgggctgggattgacaatggcatt
ccaacgctcttggtgacgacaggttttactaaggcagaagaagtagctggcctgccaatc
gcaccgacacatgtggtttctagccttgcggagtgggattttgatgaaaactaa

DBGET integrated database retrieval system