KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_06670Help
Entry
T308_06670        CDS       T02890                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00450  Selenocompound metabolism
spnn00970  Aminoacyl-tRNA biosynthesis
spnn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    T308_06670
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T308_06670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spnn01007]
    T308_06670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spnn03016]
    T308_06670
Enzymes [BR:spnn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     T308_06670
Amino acid related enzymes [BR:spnn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   T308_06670
Transfer RNA biogenesis [BR:spnn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    T308_06670
 Prokaryotic type
   Other AARSs
    T308_06670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGZ48036
Position
complement(1303110..1305107)
Genome map
AA seq 665 aa AA seqDB search
MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQK
AEEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDR
LVEFFKAHPEFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYAQDEHGNFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDVKLPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRNLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDHVLAEVAEQSIADFHTHMEAVDYPR
ALEAVWTLISRTNKYIDETAPWVLDKDEALRDQLASVMSHLAASIRVVAHLIEPFMMETS
RAVLTQLGLEEVSSLENLSLADFPADVTVVAKGTPIFPRLNMEEEIAYIKEQMEGNKPAV
EKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEVSKVEGSDKLLQFRLDAGDGEDRQI
LSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYVSQGMILSAEHDGKLTLLTVDPAVPN
GSVIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagaatttttatattacaacgccgatttactatccatctgggaaacttcat
atcggttctgcctacacaactatcgcatgtgatgtcctagcacgttacaaacgcctgatg
ggctacgatgtattttatctgacaggtcttgatgaacatggtcagaaaatccagcagaaa
gcggaagaagctggtattacacctcaagcctatgttgatggaatggcggttggagttaaa
gaactctggcaattactagatatctcatacgataaatttatccgtacaactgatgactac
catgaaaaagttgttgcacaggtctttgaacgcttacttgctcaagatgatatctacttg
ggtgaatactctggttggtattcagtatcagacgaagaattctttacagaaagccagctg
gcagaagttttccgtgatgaagctggaaatgtgactggtggtattgctccatcaggtcat
gaggttgaatgggtttctgaagaatcatacttccttcgccttagcaaataccaagaccgt
ttggtcgaatttttcaaagctcatcctgaatttatcacgccagatggtcgccttaatgaa
atgctacgcaacttcatcgagccaggtttggaagatttggcggtatctcgtacaaccttt
acatggggagtgcctgtcccatcaaatccaaaacacgttgtctacgtttggattgatgcc
cttcttaactatgcgacagctcttggctacgctcaagacgaacatggtaactttgacaag
ttctggaatggaacagtcttccatatggtaggaaaagatatccttcgcttccactctatc
tactggccaatccttcttatgatgttggatgttaaattacctgatcgtttgattgcccat
ggttggtttgtcatgaaagacggaaaaatgtctaagtcaaaagggaatgtcgtttaccct
gaaatgttggtagagcgttatggactagatccacttcgttactacctcatgcgtaacctt
ccagttggttcagacggaacctttactcctgaagactatgtcggccgtatcaactatgaa
ttggctaatgaccttgggaacctccttaaccgtacggtttccatgattaataagtacttt
gatggacaaatccctgcctatgtagaaggtgtgactgaatttgatcatgttcttgctgag
gttgcagaacaatcaatcgcagacttccatacacacatggaagcagttgactatccacgt
gcgcttgaagcagtctggactctgatctctcgtaccaataaatacatcgatgagactgca
ccatgggtcttggacaaggatgaagctcttcgtgaccaattggcaagtgtcatgagccac
ttggcagccagcattcgtgtagttgctcacttgattgaaccatttatgatggaaactagt
cgtgcagttttgactcaacttggtttggaagaagtttctagtcttgaaaacttgagtttg
gctgacttcccagcagatgtgactgtagttgccaaaggaacacctatctttccacgtcta
aatatggaagaagaaatcgcctatatcaaggaacaaatggaaggcaataaaccagcagtc
gaaaaagaatggaatccggacgaagttgagctcaaactaaacaaggatgaaatcaagttt
gaagactttgacaaggttgaaatccgtgtggcagaagtcaaagaagtgtctaaagtagaa
ggttcagataagttgcttcaattccgcttggatgctggtgatggagaagatcgtcagatt
ctttcaggaattgcaaaatactatccaaatgaacaagaattggtcggcaagaaagttcaa
atcgttgctaacctcaaaccacgtaaaatgatgaaaaaatatgtcagccagggtatgatt
ctctcagctgaacatgatggcaaattaacccttctcacagttgatccagctgtaccaaat
ggaagtgtgattgggtaa

DBGET integrated database retrieval system