KEGG   Streptococcus pneumoniae A026 (serotype 19F): T308_09935Help
Entry
T308_09935        CDS       T02890                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
spnn  Streptococcus pneumoniae A026 (serotype 19F)
Pathway
spnn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spnn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T308_09935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spnn01007]
    T308_09935
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spnn03016]
    T308_09935
   03029 Mitochondrial biogenesis [BR:spnn03029]
    T308_09935
Enzymes [BR:spnn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     T308_09935
Amino acid related enzymes [BR:spnn01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   T308_09935
Transfer RNA biogenesis [BR:spnn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    T308_09935
 Prokaryotic Type
   Other AARSs
    T308_09935
Mitochondrial biogenesis [BR:spnn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    T308_09935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A DUF455
Motif
Other DBs
NCBI-ProteinID: AGZ48573
Position
1901592..1903283
Genome map
AA seq 563 aa AA seqDB search
MNTKELIASELASIIDSLDQEAILKLLETPKNSEMGDIAFPAFSLAKVERKAPQMIAAEL
AEKMNSQAFEKVVATGPYVNFFLDKSAISAQVLQAVTTEKEHYADQNIGKQENVVIDMSS
PNIAKPFSIGHLRSTVIGDSLSHIFQKIGYQTVKVNHLGDWGKQFGMLIVAYKKWGDEEA
VKAHPIDELLKLYVRINAEAENDPSLDEEAREWFRKLENGDEEALALWQWFRDESLVEFN
RLYNELKVEFDSYNGEAFYNDKMDAVVDILSEKGLLLESEGAQVVNLEKYGIEHPALIKK
SDGATLYITRDLAAALYRKNEYQFAKSIYVVGQEQSAHFKQLKAVLQEMGYDWSDDITHV
PFGLVTKEGKKLSTRKGNVILLEPTVAEAVSRAKVQIEAKNPELENKDQVAHAVGIGAIK
FYDLKTDRTNGYDFDLEAMVSFEGETGPYVQYAYARIQSILRKADFKPETAGNYSLNDTE
SWEIIKLIQDFPRIINRAADNFEPSIIAKFAISLAQSFNKYYAHTRILDESPERDSRLAL
SYATAVVLKEALRLLGVEAPEKM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaaagaattgattgctagcgaattggctagcatcattgatagcctggaccaa
gaggctattttaaagttactggaaacccctaaaaactcagaaatgggtgacatcgctttc
cctgctttttctcttgccaaagtcgaacgtaaagcaccacaaatgattgcggctgaactg
gctgaaaaaatgaacagccaagcctttgaaaaagttgtcgcaacaggaccttacgttaac
tttttccttgataaatctgccatttctgctcaagtattgcaagctgttaccactgaaaaa
gaacactatgctgaccaaaatattggtaaacaagaaaatgttgttatcgacatgtctagt
ccgaatatcgctaaaccattttctattggccacctgcgttcaactgttatcggagatagc
ttgtcacatattttccaaaaaatcggttatcaaacggtcaaggtcaaccatttgggagac
tggggtaaacaatttgggatgttgattgttgcctacaaaaaatggggcgacgaagaagct
gtaaaagctcatccaatcgatgaactccttaaactctatgtccgcatcaacgctgaagct
gaaaatgaccctagcttggatgaagaagcgcgcgaatggttccgtaaacttgaaaatgga
gatgaggaagctctcgctctttggcaatggttccgcgatgaaagtttagtggaatttaac
cgcctttacaatgaattgaaggttgaatttgacagctataacggagaagccttctacaat
gataagatggatgcagttgtagacattctttctgaaaaaggactacttcttgaatcagaa
ggtgcccaagttgtgaatcttgagaaatatggaattgaacatccagccctcatcaagaag
tctgatggtgcaactctctatatcacacgtgacttggctgcagccctctaccgtaaaaac
gaataccaatttgctaaatctatctatgtcgttggtcaagaacaatctgcccactttaaa
cagctcaaagctgtcttgcaagagatgggctacgactggagtgacgacattactcacgtt
ccttttggtttggttacaaaagaagggaagaaactctctactcgtaaagggaatgtcatc
ttgctagagcctactgttgcagaggctgttagccgtgccaaggtccaaatcgaggctaaa
aatcctgaactagaaaacaaagaccaagtagcacatgctgttgggattggagccattaaa
ttctatgacctcaaaaccgaccgtacaaatggatacgacttcgacctagaggctatggta
tccttcgagggtgaaactggaccttacgttcaatatgcctacgctcgtatccaatctatc
ttacgcaaagccgatttcaaaccagaaacagctggcaactatagcttgaatgatactgaa
agctgggaaatcattaaactcattcaagacttcccacgtattatcaaccgtgcggcagat
aactttgaaccttctatcattgctaaatttgcaattagcctggctcaatcctttaacaaa
tactatgcacatacacgtatcttggatgaaagcccagaacgcgacagccgtctagccctc
agctacgcaaccgcagtcgttctcaaagaagcccttcgcttgcttggagtagaagcgcca
gagaagatgtaa

DBGET integrated database retrieval system