KEGG   Streptococcus pneumoniae SPN994039 (serotype 3): SPN994039_02320Help
Entry
SPN994039_02320   CDS       T02631                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
spno  Streptococcus pneumoniae SPN994039 (serotype 3)
Pathway
spno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SPN994039_02320 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spno03011]
    SPN994039_02320 (rplV)
Ribosome [BR:spno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SPN994039_02320 (rplV)
  Bacteria
    SPN994039_02320 (rplV)
  Archaea
    SPN994039_02320 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCP33926
Position
220354..220698
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPNKAAEIILKVLNSAVA
NAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtacgtgtttcacctcgtaaa
tcacgtcttgttcttgataacatccgtggtaaaagcgtagccgatgcaatcgcaatcttg
acattcactccaaacaaagctgctgaaatcatcttgaaagttttgaactcagctgtagct
aacgctgaaaacaactttggtttggataaagctaacttggtagtatctgaagcattcgca
aacgaaggaccaactatgaaacgtttccgtccacgtgcgaaaggttcagcttcaccaatc
aacaaacgtacagctcacatcactgtagctgttgcagaaaaataa

DBGET integrated database retrieval system