KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_02810Help
Entry
SPN034183_02810   CDS       T02629                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu00561  Glycerolipid metabolism
spnu00640  Propanoate metabolism
spnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPN034183_02810 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPN034183_02810 (gldA)
Enzymes [BR:spnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SPN034183_02810 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: CCP31991
Position
257607..258695
Genome map
AA seq 362 aa AA seqDB search
MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVL
ALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTD
APVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARA
VMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEAKVVTPALENIVEANTLLS
GLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLVQLLLENRPKEELDKYIEFY
KKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQAIIAVDAYVN
SK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttttgctagtccttctagatatattcagggggaaaatgccttgtttgaaaat
gccaaatcaattttggatttgggaaattacccgattctattatgcgatcagttggtttat
gatattgttggaaaacgatttgaagattatctacataggtatggtttccatattgttctg
gcgctatttaatggtgaagcttctgacaatgaaatcaatcgagttgttgccttggctgag
aaagaaaattgtgatagtattatcggtcttggtgggggaaagacgattgatagcgcaaaa
gctattgcagatttgattgaaaagcctgttattattgctccaacaattgcatcgaccgac
gcacctgtatctgctttatctgttatttatacagatgaaggtgcatttgatcattatcta
ttttattctaaaaatccagatttagttttggttgatacaaaagttatttcacaagcccct
aagcgtttattagcgtctggtattgcagatggtttagcaacttgggttgaggcgcgtgcg
gttatgcaggcaaatggaaaaactatgttgggacaacagcaaacattggctggagttgca
attgcgaagaaatgtgaagaaacgctgtttgcagatggtttacaggctatggcagcttgt
gaagctaaagtggtgacaccagcattagaaaatattgttgaagctaatactttattgagt
ggtctaggttttgaaagtggaggattagctgcggcgcatgcaattcataatggttttact
gcattgacaggtgacattcatcatttaacacatggtgaaaaagtagcttatggaacttta
gtacaactattattggaaaatagacctaaagaagaacttgataagtatattgagttttac
aaaaaaattggtatgccaacaactctaaaagaaatgcatttggatcaagttggatatgat
gatttaataaaagttggtaaacaagcaactatggagggtgagacaattcatcagatgccg
tttaagatttcgccttcagatgttgctcaagctattatcgctgtagatgcctatgtaaat
tcaaaataa

DBGET integrated database retrieval system