KEGG   Streptococcus pneumoniae SPN034183: SPN034183_14780Help
Entry
SPN034183_14780   CDS       T02629                                 

Definition
(GenBank) putative N-acetylmannosamine-6-phosphate 2-epimerase
  KO
K01788  N-acylglucosamine-6-phosphate 2-epimerase [EC:5.1.3.9]
Organism
spnu  Streptococcus pneumoniae SPN034183
Pathway
spnu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:spnu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPN034183_14780
Enzymes [BR:spnu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.9  N-acylglucosamine-6-phosphate 2-epimerase
     SPN034183_14780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NanE IMPDH Dus IGPS His_biosynth ThiG FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCP33188
Position
complement(1503415..1504113)
Genome map
AA seq 232 aa AA seqDB search
MPQISKEALIEQIKDGIIVSCQALPHEPLYTEAGGVIPLLVKAAEQGGAVGIRANSVRDI
KEIKEVTKLPIIGIIKRDYPPQEPFITATMKEVDELAELDIEVIALDCTKRERYDGLEIQ
EFIRQVKEKYPNQLLMADTSIFEEGLAAVEAGIDFVGTTLSGYTSYSPKVDGPDFELIKK
LCDAGVDVIAEGKIHTPEQAKQILEYGVRGIVVGGAITRPKEITERFVASLK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccacagattagcaaagaagccttgattgagcaaatcaaagatggaatcatcgtttct
tgtcaggctcttcctcatgaaccgctttatacagaagcgggaggggtgattcccttgctg
gtcaaagcggctgagcaaggtggagcagtcggtatccgagcaaacagtgttcgcgatatc
aaggaaattaaggaagtcactaaacttccaatcattgggattatcaaacgtgattatcca
cctcaggaacccttcatcacggctactatgaaagaagttgatgaattggcagaactggac
atcgaggtgattgctctggattgtaccaagcgtgaacgctacgatggtttggaaattcaa
gagttcattcgtcaggttaaggagaaatatcctaatcagcttttgatggctgatactagt
atcttcgaagaagggctagcagctgtagaagcaggaattgactttgtcggaacaacctta
tcaggctacacatcctacagtccaaaagtagacggtccagattttgaattgattaagaaa
ctctgtgatgctggtgtagatgtcattgcagaaggaaaaattcatacaccagaacaagcc
aaacaaatccttgaatatggagtgcgaggcatcgttgttggtggcgccattactagacca
aaagagattacagaacgcttcgttgctagtcttaaataa

DBGET integrated database retrieval system