KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_14970Help
Entry
SPN034183_14970   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase
Motif
Other DBs
NCBI-ProteinID: CCP33207
Position
complement(1527825..1528616)
Genome map
AA seq 263 aa AA seqDB search
MKIPLLTLARHKFVYVLLTLLFLALVYRDVLMTYFFFDIHAPDLAKFDGQAIKNDLLKSA
LDFRILQFNLGFYQSFIIPIIIVLLGFQYIELKNKVLRLSIGREVSYQGLKRKLTLQVAS
IPCLIYLVTVLIIAIVTYFFGTFSPLGWNSLFSDGSSLQRLLDGEITSYLFFTCVLLIGI
FINAVYFFKIVDYLGNVTRSAITYLMFLWLGSMLLYSALPYYMVPMTSLMQASYGDVSLM
KLFTPYILYIVPYMVLEKYEDNV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctctcttaactttggcaaggcataaatttgtttatgtcttgcttactttg
ctttttcttgctttggtttatcgtgatgttttgatgacttatttcttttttgatattcat
gcgcccgatctagctaaattcgatggacaagcaattaaaaatgacttattaaaatcagca
ttagattttcgtattctccagttcaatctaggtttttatcaatcatttattattccaatc
atcattgttttgctaggttttcaatatattgagctgaaaaataaagttttacgattgagt
attggaagagaagtgagttatcaagggttaaaaagaaagttgactttgcaagttgcaagt
atcccttgtttgatatatttagtgactgtgctgataattgcaattgtaacctatttcttt
gggactttttctcctcttggatggaattctctattttctgatgggagtagtttacaaagg
ctcctagatggagagataacaagctatttgttctttacttgtgtcctactaatcggtatt
ttcatcaatgcagtctatttttttaaaatagttgattatttaggaaatgtgactcgttcg
gcaatcacctatttgatgtttctttggcttggttctatgctgctctatagtgccttgcct
tactatatggttcctatgacgagtttgatgcaagctagctatggggatgtaagtttgatg
aaactctttactccttatatcctttatattgtcccttacatggtgcttgaaaaatatgaa
gataatgtttaa

DBGET integrated database retrieval system