KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15030Help
Entry
SPN034183_15030   CDS       T02629                                 

Gene name
dnaB
Definition
(GenBank) replication initiation and membrane attachment protein
  KO
K03346  replication initiation and membrane attachment protein
Organism
spnu  Streptococcus pneumoniae SPN034183
Brite
DNA replication proteins [BR:spnu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SPN034183_15030 (dnaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_2 Senescence_reg
Motif
Other DBs
NCBI-ProteinID: CCP33213
Position
complement(1532633..1533802)
Genome map
AA seq 389 aa AA seqDB search
MKPIDRFSYLKNNRVSQDTSSLVQCYLPIIGQEALSLYLYTISFWDNGRKEYLFSSILNH
LNFGMDRLIKSLKILSAFNLLTLYQKGDVYQLALHAPLSSQDFLEHPVYRRLLEKKIGDS
AVEDLKVESADGEEIPVSLNQVFPELAELGSQEDLGLKKKVANDFDLEHFRQLMARDGLR
FADEQSDVLNLFAIAEEKKWTWFETYQLAKSTAVSQVISTKRMREKIAQKPVSSDFSLKE
TTIIKEAKSKTALQFLAEIKQTRKGTITQTERELLQQMAGLGLLDEVINIILLLTFNKVD
SANINEKYAMKVANDYAYQKIHSAEKAVLRIRERGQKAKTQKQNQTAPVKTNVPKWSNPE
YKNETSEETRLELERKKQELLARLEKGGD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattgaccgtttttcttatctaaagaataatcgggtgtcgcaagatacctca
tctctggtacagtgctacctcccgattatcggtcaggaggcactgagcctttatctttat
acaatcagtttttgggataatggtagaaaggaatatcttttttcaagtatcctcaatcat
ctcaactttgggatggatagactgataaaatcattgaaaatcttatctgcttttaatctc
ttgaccctctatcaaaagggggatgtttatcagctagccctccatgctcctctatctagt
caagacttcttggagcatcctgtttatcgcagactcttagagaaaaagattggcgactct
gctgtggaggatttgaaagttgaaagtgctgatggtgaagaaatacctgtctcactcaat
caagtctttccagaattggcagaactaggcagtcaagaagaccttggtctcaagaagaaa
gtggccaatgattttgacttggaacattttcgccagctgatggctcgagatggacttcgt
tttgcggatgagcagtccgatgtcctaaacctctttgctattgccgaggagaagaaatgg
acttggtttgaaacctatcaattggccaagtcaacagctgtttctcaggttatttcaacc
aaacgcatgcgtgaaaaaattgctcaaaaaccagtttcctctgactttagtcttaaggaa
acaaccattatcaaagaagccaaaagtaaaactgccctgcagttcttggcagaaatcaag
caaacacgcaagggaaccattacccaaacagaaagagaactcttgcaacagatggctggc
ttgggcttgctggacgaagtcatcaatatcattcttttattgacctttaataaggtcgat
tcggcaaatatcaatgagaaatatgccatgaaggtagccaatgactatgcctatcaaaag
attcattcggcagaaaaggcagtcttgcgcatccgtgagcgaggacagaaagcaaaaaca
caaaaacagaatcagactgccccagtaaaaaccaatgttcctaaatggagtaatcctgaa
tataagaatgaaaccagcgaggaaactcgtctggaactagaacgtaagaagcaagaacta
ttagctcgattagaaaaaggaggagattag

DBGET integrated database retrieval system