KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15070Help
Entry
SPN034183_15070   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_5 ABC2_membrane_2
Motif
Other DBs
NCBI-ProteinID: CCP33217
Position
1535498..1536265
Genome map
AA seq 255 aa AA seqDB search
MFWNLVRYEFKNVNKWYLALYAAVLVLSALIGIQTQGFKNLPYQESQATMLLFLATVFGG
LMLTLAISTIFLIIKRFKGSVYDRQGYLTLTLPVSEHHIITAKLIGAFIWSLISTAVLAL
SAVIILALTAPEWIPLSYVITFVETHLPQIFLTGISFLLNTISGILCIYLAISIGQLFNE
YRTALAVAAYIGIQIVIGFIELFFNLSSNFYVNSLVGLNDHFYMGAGIAIVKELIFIAIF
YLGTYYILRNKVNLL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttttggaatttagttcgctacgaatttaaaaatgttaacaagtggtatttagccctc
tacgcagccgtgctagtcctttctgccctcatcggaatacagacacaaggctttaaaaat
ctaccttaccaagaaagtcaggctactatgctactttttctagctacagtctttggtggc
ttgatgcttacacttgcgatttcaaccattttcttgattattaaacgcttcaaaggtagt
gtctacgaccgacaaggttatctgactttgaccttgccagtttctgaacaccatatcatc
acagccaaactaatcggtgcctttatctggtcattgattagcactgctgtattggctcta
agtgctgttattattctggctttaacagctccagaatggattcctctttcttatgtgatt
acatttgtagaaacacatctccctcagatctttcttacaggtatatccttcctactaaat
accatttcaggaatcctctgcatctacctggctatttccattggacagcttttcaatgaa
taccgtacagcactcgctgttgcagcctacattggtatccaaatcgtcattggatttatt
gaacttttcttcaatcttagttctaatttctatgtcaattcactggtaggactcaatgac
catttctatatgggagcaggtatagccattgttaaagaactcatattcatagctatcttt
tatctcggaacctactacatcttgagaaataaggttaatttgctttaa

DBGET integrated database retrieval system