KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15090Help
Entry
SPN034183_15090   CDS       T02629                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Module
spnu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spnu02000]
    SPN034183_15090
Transporters [BR:spnu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SPN034183_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 APS_kinase AAA_15 SMC_N IstB_IS21 NTPase_1 AAA_23 AAA_19 SbcCD_C NB-ARC AAA_30 Zeta_toxin AAA_16 MobB TsaE AAA_29 AAA AAA_22
Motif
Other DBs
NCBI-ProteinID: CCP33219
Position
complement(1537814..1538707)
Genome map
AA seq 297 aa AA seqDB search
MLEVRSLEKSFGSKQVLFGIDFQARPGRILGLVGKNGAGKTTIFHSILKFLEYQGEIGLD
GQDIRQETYARIGYLPEERSLMPKLTVLEQVRYLATLKGMDAKEVKEKLPQWMKRLEVKG
KLTDKIKSLSKGNQQKIQLIITLIHEPDLIILDEPFSGLDPVNTELLKQVIFQEKERGAT
IIFSDHVMTNVEELCDDILMIRDGRVVLHGPVQDVRNQYGKTRLFVSSERSKEELENLPH
VKQVSLTKQGSWKLILEDESAGRELFPILTQGQYIATFDQQAPTIDEIFKLESGVEV
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagtaagaagtctagagaaaagttttggctccaagcaagttttgtttggtatt
gactttcaagcgcgaccaggtcgtattttgggactagtcggaaaaaatggtgctggaaaa
acaacgattttccatagtattttgaaattcctagaatatcagggagaaatcggtctggat
ggtcaggatattcgtcaggagacctatgctcggattggttatctgcctgaagaacgcagt
ctcatgcctaaattgacagttcttgaacaagttcgctacttggcgactctaaaaggcatg
gatgccaaagaagtcaaagaaaaactccctcaatggatgaagaggttggaagtgaaagga
aagctgacagataaaatcaagagtctgtcaaaaggaaatcagcagaagattcagctcatt
attactctgattcatgaaccagacctgattatcttggatgagccttttagtggattggac
ccagttaatacagaattgctcaaacaagtcatttttcaggaaaaagagcgcggagcaacc
attatcttttctgaccatgtcatgaccaatgttgaggaactttgtgacgatattctgatg
atccgagatggccgtgtggtcttgcacggaccagttcaggatgtccgcaatcaatacggg
aaaacgcgtctctttgtttcaagtgaacgaagcaaggaagaattggaaaatcttcctcat
gtcaaacaggtgagcttgaccaaacaaggcagttggaaattgattttggaggatgagagc
gctggaagggaactcttcccaatcttgactcaaggtcaatatatcgcaacatttgaccaa
caagcgccaactatcgatgaaatctttaaactagaatcaggagtggaagtatga

DBGET integrated database retrieval system