KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15100Help
Entry
SPN034183_15100   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: CCP33220
Position
1540022..1540639
Genome map
AA seq 205 aa AA seqDB search
MSQDKQMKAVSPLLQRVINISSIVGGVGSLIFCIWAYQAGILQSKETLSAFIQQAGIWGP
PLFIFLQILQTVVPIIPGALTSVAGVFIYGHIIGTIYNYIGIVIGCAIIFYLVRLYGAAF
VQSVVSKRTYDKYIGWLDKGNRFDRFFIFMMIWPISPADFLCMLAALTKMSFKRYMTIII
LTKPFTLVVYTYGLTYIIDFFWQML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggataaacaaatgaaagctgtttctccccttctgcagcgagttatcaatatc
tcatcgattgtcggtggggttgggagtttgattttctgtatttgggcttatcaggctggg
attttacaatccaaggaaaccctctctgcctttatccagcaggcaggcatctggggtcca
cctctctttatctttttacagattttacagactgtcgtccctatcattccaggggccttg
acctcggtggctggggtctttatctacgggcacatcatcgggactatctacaactatatc
ggcatcgtgattggctgtgccattatcttttatctagtgcgcctatacggagctgccttt
gtccagtctgtcgtcagcaagcgcacctacgacaagtacatcggctggctagataagggc
aatcgttttgaccgcttctttatttttatgatgatttggcccattagcccagctgacttt
ctctgtatgctggctgccctgaccaagatgagtttcaagcgctacatgaccatcatcatt
ctgaccaaaccctttaccctcgtggtttatacctacggtctgacctatattattgacttt
ttctggcaaatgctttga

DBGET integrated database retrieval system