KEGG   Streptococcus pneumoniae SPN034183: SPN034183_15190Help
Entry
SPN034183_15190   CDS       T02629                                 

Definition
(GenBank) putative membrane protein
Organism
spnu  Streptococcus pneumoniae SPN034183
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThrE_2 ThrE HPP Hanta_G1 TrbL
Motif
Other DBs
NCBI-ProteinID: CCP33229
Position
complement(1550321..1550656)
Genome map
AA seq 111 aa AA seqDB search
MTVWLIYLLLKEPTNVIVATFIAAIIGSCVSQILSILYKTPAVVFILAILAPLVPGYLSY
RTTAFFVTGDYNKALASATLVVMLALVISIGMASGTVILRLYHYIKTHRVS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgactgtctggctaatctatctcttgctcaaggaaccgaccaatgtcattgtagctacc
ttcattgcagccattattggttcttgtgtcagccagattttaagtattctttataagaca
cctgctgtggtctttatcttggccattttggcaccgctggttccaggttatctctcctac
cgaacaactgccttttttgtgacaggggactataataaagcactggcaagtgcgaccttg
gttgtcatgttggctttggtaatctctattggaatggctagcggaacagtgattctcaga
ctgtatcattatataaaaacacatcgagtatcgtag

DBGET integrated database retrieval system