KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15220Help
Entry
SPN034183_15220   CDS       T02629                                 

Definition
(GenBank) putative protein phosphatase
  KO
K20074  PPM family protein phosphatase [EC:3.1.3.16]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:spnu01009]
    SPN034183_15220
Enzymes [BR:spnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SPN034183_15220
Protein phosphatases and associated proteins [BR:spnu01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    SPN034183_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C SpoIIE Suppressor_APC
Motif
Other DBs
NCBI-ProteinID: CCP33232
Position
complement(1553621..1554361)
Genome map
AA seq 246 aa AA seqDB search
MEISLLTDVGQKRTNNQDYVNHYVNRAGRTMIILADGMGGHRAGNIASEMAVTDLGVAWV
DTQIDTVNEVREWFAHYLEIENQKIHQLGQDEAYRGMGTTLEVLAIIDNQAIYAHIGDSR
IGLIRGEEYHQLTSDHSLVNELLKAGQLTPEEAEAHPQKNIITQSIGQKDEIQPDFGTVI
LESGDYLLLNSDGLTNMISGSEIRDIVTSDIPLADKTETLVRFANNAGGLDNITVALVSM
NEEDEE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttcattattaacagatgttggtcagaaacgaacaaataaccaagactatgtc
aaccactatgtcaatagagctggacgtaccatgattattttagctgatgggatgggaggt
catcgcgcagggaatatcgctagtgaaatggcggtgacagacctgggtgtagcttgggtt
gatacccagatcgatacagtcaatgaagtgcgtgaatggttcgcccattacctagaaatt
gaaaatcaaaagattcaccagcttggtcaggatgaagcttacagaggcatgggaactact
ttggaagtccttgctattattgataatcaggctatctatgctcatattggtgattcgcgt
atcggcttgattcgtggagaagaataccatcagttgacgagcgatcattctttggttaat
gaattgctcaaggctggtcaattgacaccagaagaggcagaagctcatccacaaaaaaat
attatcacccagtctattgggcaaaaagatgaaattcagcctgattttgggacagttatc
cttgagtcaggtgactatctcttgctcaatagtgacggcttgaccaacatgatttcaggc
agtgagattcgtgatattgtaaccagtgatattcctttagcagataaaacggagacactt
gttcgttttgctaacaatgcaggaggtttagacaacattacggttgcccttgtttctatg
aacgaggaggatgaagaatga

DBGET integrated database retrieval system