KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15240Help
Entry
SPN034183_15240   CDS       T02629                                 

Gene name
fmt
Definition
(GenBank) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu00670  One carbon pool by folate
spnu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPN034183_15240 (fmt)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPN034183_15240 (fmt)
Enzymes [BR:spnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SPN034183_15240 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Motif
Other DBs
NCBI-ProteinID: CCP33234
Position
complement(1555682..1556617)
Genome map
AA seq 311 aa AA seqDB search
MTKLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLS
IYQPEKLSGSPEMEDLMKLGADGIVTAAFGQFLPSKLLDSMDFAVNVHASLLPRHRGGAP
IHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDT
LPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKG
DRFKIYEALPVEGQGNPGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNGVG
RTLTVGERFGD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaactaatctttatggggacccccgacttttcagcaacagtcttaaaaggactt
ttgacagatgaccgttacgaaattctagccgttgtgacccagccagaccgtgctgttggt
cgtaaaaaagttatccaagaaaccccagtcaagcaggctgccaaggaagcaggactatct
atctaccaacctgaaaaattatctggaagtccagagatggaagatcttatgaagctagga
gcagatggaattgtgactgctgcttttgggcagtttctcccaagcaaactccttgatagc
atggactttgctgtcaacgttcatgcctccctccttcctagacaccgtggtggtgcgcct
atccattatgccttgattcaaggggatgaggaagctggtgtgaccatcatggaaatggtt
aaggaaatggatgcaggagatatgatttctcgtcgcagcattccgatcacagatgaggac
aatgttggcaccttgtttgaaaaattggcgctagttggtcgtgatttgcttttggacact
ctgcctgcctatattgctggtgatatcaaacctgaaccgcaggatacgagtcaggttacc
ttctctccaaatataaagccagaggaagaaaaactggactggaacaaaaccaatcgtcaa
ctctttaaccaaattcgtggaatgaacccctggcctgttgcccatactttccttaagggc
gaccgctttaagatttatgaagccctaccagtagaaggtcagggaaatccaggtgaaatt
ctctctatcggcaagaaagaattgattgtcgcaacggctgaaggggctctatccctcaaa
caagtgcagccagctggtaagcctaagatggacattgcttccttcctcaacggagttgga
cgtacattgactgtaggagaacgatttggtgactaa

DBGET integrated database retrieval system