KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15270Help
Entry
SPN034183_15270   CDS       T02629                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Pathway
spnu00230  Purine metabolism
spnu01100  Metabolic pathways
Module
spnu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPN034183_15270 (gmk)
Enzymes [BR:spnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SPN034183_15270 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 TarS_C1 AAA_16 AAA_33 NB-ARC AAA_22 RsgA_GTPase AAA
Motif
Other DBs
NCBI-ProteinID: CCP33237
Position
complement(1559431..1560057)
Genome map
AA seq 208 aa AA seqDB search
MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTRE
EFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLDELQERLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVK
CVIEAEHFCVDRVIGHYQEMLPKSPTTR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgaggcttactaatcgttttttctggtccttcaggggttggaaaaggaacg
gttagaagagagatttttgagagttctgaaaaccaatttcaatattctgtatcgatgacg
acacgcgcacaacgtcctggagaagtggacggtgttgactatttcttccgtactcgtgaa
gaatttgaagagctgattcgtcaaggacagatgttggaatacgcagaatatgtcggcaac
tactatggaactcctctgacctatgtcaatgaaaccttggacaagggaatcgatgttttc
cttgaaattgaagttcagggtgctcttcaggtcaagaaaaaggttccagatgctgtcttt
atcttcctgacaccaccagatttggatgaattgcaagaacgcttggtaggtcgtggaaca
gatagtgcagaagtgattgcccaacgaatcgaaaaggccaaggaagaaattgccctcatg
cgtgagtatgattatgcgattgtcaacgatcaggtacccctagctgctgaacgtgtcaaa
tgtgtgattgaagcagaacacttctgtgtggatcgtgtcattggtcactatcaggagatg
ttaccaaaatctccaactacccgataa

DBGET integrated database retrieval system