KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15300Help
Entry
SPN034183_15300   CDS       T02629                                 

Definition
(GenBank) nucleotidyltransferase
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIGH_NTase1 Citrate_ly_lig CTP_transf_like Sec1 Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: CCP33240
Position
complement(1562550..1563647)
Genome map
AA seq 365 aa AA seqDB search
MTITGIIAEFNPFHNGHKYLLDQAEGLKIVAMSGNFMQRGEPAIVDKWTRAQMALENGAD
LVVELPFLVSVQAADFFGQGAVNILDRLGIDSLVFGTEEVRDYQKIADLYTEKGAEMEKF
VENLTDSLSYPQKTQAMWKEFAGLDFSGNTPNHVLALAYAKAVAGRNIKLHPIQRQGAGY
HSVNKDVDFASATALRQHQKDQDFLERFMPSVALFEQASKVIWEDYFPLLRYQILSNPDL
TTIYQVNQEMAVRIKEAIKTAQSVEELVELVTTKRYTKARVRRLLTYILMQARESDLPEA
IHVLGFTEKGRQHLKSLKGQVNLVSRIGKEPWDAMTQKVDQIYQLGKPSIAEQNFGRVPI
RIETN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcacaggtattatcgcggagttcaatccttttcataatggccataaatacctg
ctggatcaggcagagggactgaaaattgttgccatgtcagggaatttcatgcagcgtgga
gagcctgctattgtggataagtggacaagggcccagatggcgctggaaaatggcgcagac
ttggtagtggaattgccctttttagtcagtgttcaggcagctgatttctttggtcaagga
gctgtgaatatcttggatcgcttgggcattgatagtctagtttttgggacagaggaagtt
cgagattatcagaaaatcgctgacttatacacagagaaaggtgctgagatggagaaattt
gtggaaaatctgactgattccctttcctatccccagaaaacccaagctatgtggaaggaa
tttgctggtcttgatttttcaggtaatacccccaatcatgttcttgctctggcctatgcc
aaggcggttgcaggacggaatatcaagctgcatccgattcagcgtcagggggcaggttac
cattctgtgaataaagatgtggactttgcctcggcgacagccctccgtcaacatcagaag
gaccaagatttcttagaacgttttatgccttctgttgccctatttgagcaggccagtaag
gtgatctgggaagactattttcccttgctccgctatcaaatcttgtcaaatcccgaccta
accaccatctatcaggtcaatcaagaaatggctgtgcgcattaaagaagctattaaaaca
gcccagtctgtggaagaattggtcgagttagtgactaccaaacgttacaccaaggcgcgt
gtcagacgcctattgacctatattttgatgcaggctagagaaagtgacttgccagaagcc
attcatgtccttggatttactgaaaaaggcaggcaacatctcaagtctctgaaaggacag
gtcaatctagtcagccgaattggcaaagaaccttgggatgctatgactcaaaaggttgac
cagatttaccaactaggaaagccaagtatagcagagcaaaattttggaagagtgccgatt
agaatagaaacaaactaa

DBGET integrated database retrieval system