KEGG   Streptococcus pneumoniae SPN034183 (serotype 3): SPN034183_15380Help
Entry
SPN034183_15380   CDS       T02629                                 

Definition
(GenBank) putative hydrolase
  KO
K07015  uncharacterized protein
Organism
spnu  Streptococcus pneumoniae SPN034183 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPN034183_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase PGP_phosphatase Hydrolase_3 Hydrolase_6 VPS53_C HAD DUF705 AhpC-TSA SepSecS
Motif
Other DBs
NCBI-ProteinID: CCP33248
Position
complement(1568282..1568809)
Genome map
AA seq 175 aa AA seqDB search
MAIENYIPDFAVEAVYDLTVPSLQAQGIKAVLVDLDNTLIAWNNPDGTPEMKQWLHDLRD
AGIGIIVVSNNTKKRVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVVMVGDQL
MTDIRAAHRAGIRSILVKPLVQHDSIKTQINRTRERRVMRKITEKYGPITYKKGI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaaaattatataccagattttgctgtggaagcagtctatgatctgacagtc
cccagcctgcaggcgcagggaatcaaggctgttttggtcgatttggataataccctcatt
gcttggaacaaccctgatggaacgccagagatgaagcaatggctacatgaccttcgggac
gcgggtattggcattatcgtagtgtcaaataacaccaaaaaacgcgttcaacgagcagtt
gagaaatttgggattgattacgtttactgggccttgaagcccttcacatttggtattgac
cgtgctatgaaggaattccactatgacaaaaaggaagtggtcatggttggtgaccagctc
atgacagatatacgagcagcccaccgtgcagggattcggtcaattttagtcaaacccttg
gtccaacatgactcaatcaaaacgcagattaaccgaactcgtgagcgtcgtgttatgaga
aaaatcactgaaaagtacggaccgattacatataaaaaaggaatttaa

DBGET integrated database retrieval system